SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006826 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006826
Domain Number 1 Region: 196-319
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.5e-32
Family Reprolysin-like 0.00024
Further Details:      
 
Domain Number 2 Region: 409-483
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 6.54e-19
Family Blood coagulation inhibitor (disintegrin) 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006826
Domain Number - Region: 365-422
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00214
Family Reprolysin-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006826   Gene: ENSDORG00000007281   Transcript: ENSDORT00000007281
Sequence length 774
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2859:27057:58690:1 gene:ENSDORG00000007281 transcript:ENSDORT00000007281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPHHVLLMILLTSLIKEKVILGVEGQELVYPKRLPLVQKRDLGHIHDFNAQEIYEILYE
IKLXXXXXXXXXXXXXDLLASNYSEAYYNVKGEVLTRHPQIMDHCFYQGSIVHEYDSAAS
ISTCNGLRGFFRVNDQRYLIEPLKYSDGRQHLVFKYATRMPYTANHSCEELNFTKEIVPQ
EENDKEDQKAESARKESYVELFVVADDYVFRRNSKPHSKIRKRIWGMVNFVNMVYKTLNI
HVTLVGIEVWTNGDQIEVDPNIETTLSHFSTWQETVLKKRKHYDHVLLLSGKWLQAHAQG
ISYPAGMCLPHYSCSVVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXIPALKFSKCSQAQYQQYLKNAKPTCMLNIPFPDSFNDLPSCGDKKVDEGEECDCGSVQ
ECTNPCCDAHRCLLKPGFDCAQGECCESCHIKKEGSPCRPAKDECDLPEVCSGHSPECPP
DQFQPSGTPCKNAEGYCSLGKCPTRDQQCHALFSGGAKESHDACYKMNKKGNKFGYCKNK
ENGFAPCEEKDVKCGKLFCTGRQLSPLRGEDKTYYLKLPQPNATCQCRTVFFYHNAEDVG
LVDSGTKCGDGMVCSNGECVSLQKAYNSTSCSSQCDENSMDGREPQCQCAEEQTLTDWGE
SFNLSSISIVVIVIAGLIAGVATVTLLIRYQKCIKLKQVQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQRASESLESLPSGFPSPHYITLKSASQDPRGVTDPNQSAK
Download sequence
Identical sequences ENSDORP00000006826 ENSDORP00000006826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]