SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006875 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006875
Domain Number 1 Region: 304-414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 123-243
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000667
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 3 Region: 479-541
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000917
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 547-606
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000127
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 69-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 420-477
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000389
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 7 Region: 243-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000418
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006875   Gene: ENSDORG00000007332   Transcript: ENSDORT00000007331
Sequence length 699
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1062:8575:35938:1 gene:ENSDORG00000007332 transcript:ENSDORT00000007331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKSVNLSEGELLSIRGVDGPALTVLANQTLLVEGQVVRSPTNTISVYFRTFQDDGLGTFQ
LHYQAFMLSCSFPRRPDAGDVTVMDLHAGGLAHFHCHLGYELQGAKTLTCMNASKPHWSS
PEPVCSAPCGGAVRNATIGRVLSPSAQGHNGTQLCVWTVEAPEGQKLHLHLEKLALHGRD
RMAVYSGLSNASALLYDSLRAQSVPFEGLLSEQNAVRIEFSSPQGPGASAFNIRFEAFEK
GHCYEPYIQNGNFSTSDPTYNVGAVVEFTCDPGHSLEQGPAVIECVNVRDPYWNDTEPLC
RAMCGGELTAVAGVVLSPNWPEPYAEGEDCVWRIHVGEEKRIFLDVQFLNLSHSDVLTVY
DGDEVTPHILGQNLGSSGPQRLYSSTPDLTIHFHSDPAGLIFGKGQGFIINYVEVSRNDS
CSDLPEINGWKTTSHAELVRGARVTYQCDLGYDIVGGDTLVCQWDLSWSGDSLFCEKIMY
CTDPGEVEHSTRLISDPVLLVGATIQYACNPGFVLEGSSLLTCYSRETGTPIWTSRLPRC
VSEESLACDNPGLPENGYQILYKRLYLPGEFLTFMCYEGFELTGEVTIRCILGQPSHWNG
PLPVCKVNQDSFEHALEVAEAAAESSLEGGNMALAIFIPVLVISLLLGGAYVYVTRCRYY
SSLRLPLMYAHPYSQITVETEFDNPIYETGKTREYEVSI
Download sequence
Identical sequences ENSDORP00000006875 ENSDORP00000006875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]