SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006900 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006900
Domain Number 1 Region: 374-449
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.29e-17
Family Integrin beta tail domain 0.0023
Further Details:      
 
Domain Number 2 Region: 124-205
Classification Level Classification E-value
Superfamily Integrin domains 1.94e-16
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 3 Region: 1-86
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000511
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 4 Region: 288-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family Integrin beta EGF-like domains 0.0013
Further Details:      
 
Domain Number 5 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006900
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Domain Number - Region: 253-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00949
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006900   Gene: ENSDORG00000007355   Transcript: ENSDORT00000007356
Sequence length 508
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6874:7479:17101:-1 gene:ENSDORG00000007355 transcript:ENSDORT00000007356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIGWRSVTRILVLATDRGLRYGSDEKADTLLTPSGGRCHLKDDVHRSGRGSDYPSVGQL
AHKLAESGIQTIFMVTARAVKSYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLSSRV
FLDHSPLPDTLRVTYDSFCSNGASHMGQPRGNCDGVQINVPITFQVKVTATACLQQQSFV
IRALGFTDTVTVRVLPQCQCQCRDQKQDRGLCGGKGSLECGVCRCDAGYSGKNCECQTQG
KSSQELEGSCRKDNSSLVCSGMGDCVCGQCMCHASDEPNKEIFGRYCECDNVNCERHQGQ
PCGGPKRGECFCGQCQCKPGFEGSACQCSRSTARCLNPRGVECSGRGRCQCNTCKCDPGY
QPPLCEECPGCPAPCSSYTSCVECLKFAKGPYKKNCSAACVNVRLQNATRKGRSCKERDS
DNCWISYTMQQRDGRDSYDIYVEDSRECVLAPRITITVGGNACAVLLIFLLVVIYLVLTH
FREELQPRQNHNNPLFKSALVTPKSAES
Download sequence
Identical sequences ENSDORP00000006900 ENSDORP00000006900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]