SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006911 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000006911
Domain Number - Region: 242-263
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0288
Family Cysteine-rich DNA binding domain, (DM domain) 0.011
Further Details:      
 
Domain Number - Region: 211-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0706
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006911   Gene: ENSDORG00000007369   Transcript: ENSDORT00000007369
Sequence length 351
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3533:66192:95956:1 gene:ENSDORG00000007369 transcript:ENSDORT00000007369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAACVLLWALLLSLGSRAAGARNSTSAPTMTTGMQRVSFRFGAPARSRRTTNNANQTT
LRKPKITLEDENDALATADRLAGPAAAELLATVTGISRTAIPSPNEDEDGSLEEGVVIDA
RKNNTSSGTPDTTPKKVLTSSARKVVANSQDKEIRMTTDLPPLTAKYTDELLSSVASLNQ
WSTAGSTPKTWPSSSHTAMPAPEDLRLVLMPWGPWHCHCKSGTMSRSRAGKLQGLSGRLR
VGALSQLRTEHRPCTYQQCPCNRLREECPLDTGLCAESSCSSQTTTTSRTTTTTILPPIH
LRRRPLPVPPTTPSPALAFWKRVKNGLEDIWNSLSSVFTEMQPVSKNLRRV
Download sequence
Identical sequences ENSDORP00000006911 ENSDORP00000006911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]