SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006939 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006939
Domain Number 1 Region: 348-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 2 Region: 877-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 3 Region: 783-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 938-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 5 Region: 831-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 471-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 7 Region: 1038-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family Laminin-type module 0.0028
Further Details:      
 
Domain Number 8 Region: 436-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 309-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 10 Region: 1095-1138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 11 Region: 986-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 12 Region: 1143-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000212
Family Laminin-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006939   Gene: ENSDORG00000007397   Transcript: ENSDORT00000007397
Sequence length 1796
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5363:31354:44489:-1 gene:ENSDORG00000007397 transcript:ENSDORT00000007397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERASGERGRGWRSYSVPWELGLGLLLSVLAAILAQAQALDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAP
QRRTAWWQSENGISKVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGIPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPTHAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWRPAEDGYSHACCECHGHSHSCHFD
MAMYLASGNVSGGVCDECQHHTAGHHCEVCRPFFYRDPTKDLRDPAVCRPCDCDPMGSQD
GGRCDSHDDPALGLVSGQCRCKEHVMGTRCQQCRDGFFGLSASDPQGCQRCQCNARGTVS
GTTPCDPHSGTCFCKRLVTGHGCDHCLPGHWGLSHDLLGCRPCDCDVGGALDPXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXYMMLPRPVCLEPGISYKLHLKLVRTGGSTQPAIYSGPDLLVDSLVL
LPRVLVLEMFSAGDAVALERRATFEHYRCHEEGLLPSKNPPSEACGPLLISLSTLIYNGA
LPCQCDPQGSLSSECNPHGGQCLCKPGVVGRRCDLCATGYYGFGPTGCQACQCSPEGALS
GLCEGTSGQCPCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECDSHTGACLSCRDHT
GGEHCERCLAGFHGDPRLPYGNQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCHCRAGY
TGPRCETCAPGHFGDPSKPGGRCQLCECSGNIDPKDPEACDPRTGQCLRCLYHTEGPGCA
YLQPGFHGQAAQQSCHRCTCNLLGTSSQYCPLVDQCHCDPNSGQCPCLPNVQGLSCDRCA
PNFWNLTSGHGCQPCACHPTRARGPSCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC
RACDCDPRGIDTPQCHRATGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHTCFGDWDRV
VQDLSARTRRLEQWAQELQQTGVLGAFESNFLKLQEKLGMVQTIVGARNTSAVSTTKLVE
ATEELRREIGKATEHLTQLEAGLTDIQDENFNANHALSGLERDGLALNLTLKQLDQHLDL
LKHSNFLGAFDSIRHAHSQSAEAERRANTSALAVPSPVSNSADLRRRTERLMETQRKDFN
RKHLANQQALGKLSTHTQGLSLTGINELVCGAPGDAPCASSPCGGAGCRDEDGQPRCGGL
GCSGAAATADLALSRARHTQAELQRALVDGGGILSQVAETRRQAGEAQQRAQAALDKANA
TRGQVEQANQQLRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQNLASAIA
ERVRSLADVDTILARTMGDVRRAEQLLQDAQRARSRAESEKQKAEMVQVALEEAQRAQGA
AQGAIRAAMVDTQDTEQTLNQVEKMAGAEQALGSAGERARQLDALEALKLKRAANSLAAS
TAEETADSAQSRAHEAEQLLQGTVGDQYQTVRTLAERKAQGVLAAQKRAERLRDEARNLL
QEAQDKLQKLQELEGAYEENERALEGKAAQLDGLETKMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences ENSDORP00000006939 ENSDORP00000006939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]