SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006941 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006941
Domain Number 1 Region: 264-435
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.02e-38
Family Reprolysin-like 0.003
Further Details:      
 
Domain Number 2 Region: 526-581
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000667
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 945-991
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 884-942
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 822-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000693
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006941   Gene: ENSDORG00000007399   Transcript: ENSDORT00000007399
Sequence length 1163
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4214:1365:143208:-1 gene:ENSDORG00000007399 transcript:ENSDORT00000007399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSEEILPIDLPIKGQKEYELVTPFSTNVEGHYVSHILSANHKKRSTRDVSSNSEQLFFN
ITAFGKDFHLRLKPNTQLIAPGAVVEWHETSPVPGNITGHLHDDQPGNAAETIWRTEPLQ
TNCAYVGDIVDIPGTSVAISNCDGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXSALEGLEDLGKAYSSIGQQLNETXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVNEIYHDESLGVHINVALVRMIMLGYTKSINLIERG
NPSRSLENVCRWAYQQQKPDPNHSEHHDHAIFLTRQDFGPAGMQGYAPVTGMCHPVRSCT
LNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETAMGSVMAPLVQAAFHRYHWSRCSG
QELKRYIHSYDCLLDDPFEHDWPKLPELPGINYSMDDQCRFDFGVGYKMCTAFRPCDSGI
QLCSHLNNPYFCKTKKRRALDGSECAAGKWCYKGHCMWKNANQQKQDGNWGSWTKFGSCS
RTCGTGVRFRTRQCNNPTPINGGQDCPGVNFEYQLCNTEECQKHFEDFRAQQCQQRNSHF
EYQNSKHHWLPYEHPESKKRCHLYCQSRETGDVAYMKQLVHDGTHCSYKDPYSICVRGEC
VKVGCDKEIGSNKIEDKCGVCGGDNSHCRTVKGTFTRIPRKLGYLKMFDIPHGARHVLIQ
EEEASPHILAIKNQATGHYILNGKGEEAKSRTFIDLGVEWDYSIEDDIETLHTDGPLHDP
VMVLIIPKENDTRSRLTYKYIIHEDSVPTINSNNVIQEELDTFEWALKSWSQCSKPCGGG
FQYTKYGCRRKSDNKMVHRSFCEASKKPKPIRRMCNIQECTHPLWIAEEWEHCTKTCGNS
GYQIRTVRCLQPLHDGTNRSVHSKYCVGDRPESRRPCNRGPCPAQWKTGPWNECSVTCGE
GTEVRQVLCRAGDQCDGEKPESVRACQLPPCNXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSKRSSTPPYLGEAAATHDDSIFSSSDLSKSLVMPTPLPYYSETAEKKSLGSPHA
HAAFSRRDGANSPQRGAQQAGSKTLTLVSEPSSSSTKGAGHLDSASQVAAASFLDISDST
GASSQARTSKKDDKIIRLPVLER
Download sequence
Identical sequences ENSDORP00000006941 ENSDORP00000006941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]