SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006955 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006955
Domain Number 1 Region: 330-506,541-707
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.25e-80
Family YicI catalytic domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 1204-1397,1442-1603
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.61e-73
Family YicI catalytic domain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 85-329
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-42
Family YicI N-terminal domain-like 0.0095
Further Details:      
 
Domain Number 4 Region: 1606-1686
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.04e-20
Family Putative glucosidase YicI, domain 3 0.011
Further Details:      
 
Domain Number 5 Region: 710-766
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000316
Family Putative glucosidase YicI, domain 3 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006955
Domain Number - Region: 51-108
Classification Level Classification E-value
Superfamily Kringle-like 0.0106
Family Kringle modules 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006955   Gene: ENSDORG00000007415   Transcript: ENSDORT00000007416
Sequence length 1756
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5728:5980:80034:1 gene:ENSDORG00000007415 transcript:ENSDORT00000007416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTRLKKFTTLELVLSALLLIVFIIAVVLIVLLAPRKIDTDPGTTGTPGPGTTSTTPSS
VECPVVNDLEQINCIPDQPPTKDICDQRGCCWNPQGTTDIPWCYYSKNHGYNIEGDLANT
NAXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTSNRFHFKLTDQSKDRYEVPHEHVQPFRG
NAASSLNYEVEVSKQPFSIKVTRRSNNRVLFDSGIGPLLFADQFLQLSIRLPSANVYGLG
EHVHRQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAM
EVSLQPAPAVTYRTIGGVLDFYVFLGNTPEQVVQEYLELIGLPSLPSYWTLGFHLSRYDY
GTLEKMKVVVDRNRAAQLPYDVQHGDIDYMDERKDFTYNPVGFKGLPEFVKELHGNGQKF
VIIVDPAISNNSSLSHPYSPYDRGSALKIWVNDSNGVNPLIGEVWPGKTVFPDYSNPNCA
AWWANEFALFHNQVEFDGIWIDMNEVSNFVDGSISGCATNTLNHPPFTPRVLDGYLFAKT
LCMDAVQQWGKQYDVHNLYGYSMAIATEGAVKTVFPGKRSFILTRSTFAGSGKFAAHWLG
DNSATWSDLQWSIPGMLEFNLFGIPMVGADICGFALDTSEELCRRWMQLGAFYPFSRNHN
GQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFYHAHSRGGTVARPLVHEFYE
DSNTWDVHRQFLWGPAFLITPVLEEGADRVKAYVPDAVWYDYETXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRQNPLGLIIALDENNEARGELFWDDGQSKDTVAN
NVYVLCEFSASQTHLNVTISKSAYKDPNNLAFQKIKIFGTKALSNITVKQNGVLAPMSPN
ITYDPNLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
SNIPGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSPYVTAFPSTPVSPLRLLVTYHKN
EMLQFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVIGRPVMVPYWSLGFQLCRYGYENDAEISSLYDEMVAAQIPYDVQYSDIDYMERQL
DFTLSPKFSGLPALIDRMKAAGMRVILILDPAISGNETEPYPAFTRGVEDDVFIKFPNDG
GIVWGKVWPDFPNIVVNSSLDWDSQVEQYRAYVAFPDFFRNSTALWWKREMEELYTNPQS
PEKSLKFDGMWIDMNEPSSFVNGAVAPGCRDTTLNRPPYMPHLAGRDRGLSSKTLCMESE
QILQDGSRVRHYDVHSLYGWSQTRPTYEAMQEVTGQRSIVITRSTFPSSGRWAGHWLGDN
TAAWDQLKKSIIGMMEFSLFGMSYTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNTI
GTRRQDPVSWDAAFVDISRSVLETRYTLLPYLYTLMHKANTEGVTVVRPLLHEFVSDRET
WAIDSQFLLGAAFLVSPVLEPNARNVTAYFPNAHWYDFYTGAQINASGEWKVLPAPLDHI
NLHVRGGHILPWQEPALNTHLSRQNPLGLIIALDGNNEARGELFWDDGQSKDTVANDVYI
LCEFTASQQIKQMMCD
Download sequence
Identical sequences ENSDORP00000006955 ENSDORP00000006955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]