SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006965 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006965
Domain Number 1 Region: 7-45
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000617
Family Eukaryotic proteases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006965   Gene: ENSDORG00000007426   Transcript: ENSDORT00000007426
Sequence length 50
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5728:233671:234845:-1 gene:ENSDORG00000007426 transcript:ENSDORT00000007426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYLESTPEPCVGSLIHSEWVLTAAHCPLPSKIRLGVYQPNIKNTKEQLL
Download sequence
Identical sequences ENSDORP00000006965 ENSDORP00000006965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]