SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006966 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006966
Domain Number 1 Region: 39-145
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.45e-39
Family Eukaryotic proteases 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006966   Gene: ENSDORG00000007428   Transcript: ENSDORT00000007427
Sequence length 149
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5728:241388:242640:-1 gene:ENSDORG00000007428 transcript:ENSDORT00000007427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAPNFSLTVALHPEEDDRIRGLHLCEEFPPLPGSLNAAGHICGGSLISDQWVLSAAHCY
EHRLQVHLGKHNIHAIEGDEQFIDAAKIIPHPEYKEDTIDNDIMLIKLKSPATINSRVST
VSLPRSCPSAGTQCLVSGWGNTLSNGCSV
Download sequence
Identical sequences ENSDORP00000006966 ENSDORP00000006966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]