SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006971 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006971
Domain Number 1 Region: 141-431
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.4e-75
Family Transglutaminase core 0.00000116
Further Details:      
 
Domain Number 2 Region: 2-140
Classification Level Classification E-value
Superfamily E set domains 1.99e-40
Family Transglutaminase N-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 577-675
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.54e-27
Family Transglutaminase, two C-terminal domains 0.00098
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006971
Domain Number - Region: 539-575
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00146
Family Transglutaminase, two C-terminal domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006971   Gene: ENSDORG00000007432   Transcript: ENSDORT00000007432
Sequence length 681
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3161:33201:45925:-1 gene:ENSDORG00000007432 transcript:ENSDORT00000007432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGIKSCDFQAAKNNEEHHTKAISSQHLTVRRGQPFTITVHFRTPVHTFLPTLKKVALVAQ
TGEQPSKINRTQATFSISSLGEKNQWSAVVEDRDAQCWTISVTSPVDAIIGHYSLLLQVA
GKKQYQLGQFTLLFNPWNRDDPVFLQNEAQRSEYVLNQNGLIYLGTADFIQEEPWNFGQF
QTDVVDLSLGLQGVDEQLEKWSQPMHVAQAWGVLLHALKKKRVLSTPQSQATQERALLNK
RRGSAPILRQWLTGRGRPVHESQAWVLAAVACTVLRCLGIPARVVTTFTSAQGTSGGLQV
DEYYNEEGLQNGESQTGRIWVFQTSVECWMTRLDLPQGYDGWQILYPRGWGSCDLVPVRA
VKEGALGLSPAVSELFAMVNASCVVWKCCEDGKLELTNSNTKYVGNNISTKVVGSDRCED
ITHNYKYPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
HFERNPPENTFLRITAVATHSESSLSCFAQEDVAIRRPHLVIKMPERAKQFQPLTVSVSI
HNSLDSPVKDCMISIFGRGLIHKERRYRLGSVWPGNTLRTQVQFTPTQLGLHWLTVEMDC
DMFQNLTSYKSITIEAPELSA
Download sequence
Identical sequences ENSDORP00000006971 ENSDORP00000006971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]