SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006972 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006972
Domain Number 1 Region: 288-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.69e-68
Family Transglutaminase core 0.00000202
Further Details:      
 
Domain Number 2 Region: 619-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.11e-28
Family Transglutaminase, two C-terminal domains 0.00025
Further Details:      
 
Domain Number 3 Region: 505-616
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.85e-26
Family Transglutaminase, two C-terminal domains 0.00032
Further Details:      
 
Domain Number 4 Region: 184-229
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000858
Family Transglutaminase core 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006972   Gene: ENSDORG00000007433   Transcript: ENSDORT00000007433
Sequence length 719
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3161:54859:76190:-1 gene:ENSDORG00000007433 transcript:ENSDORT00000007433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXFEENILDICLELLDKSLHFQIDPSTDCALRGSPVYISRVVCAMXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNYHVWNECWMDRKDLPSGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVNLNYDTRFAFSMVNADCMSWLVQGGKEQKLHQDT
TTVGNFISTKSIQSDQRDDITENYKYEEGSPQERQVYYKALQKLKDGRSQGSDSASSVPS
RRMPPSQDTPRSLDTPALQPSSVIQVSLKFKLLDPPNMGQDINFALLALNMSPQFKDLKV
NLSAQSLLHDGSPLCPFWQDTAFITLFPEEAKTYPCKIPYSQYSQYLSTDKLIRISALGE
EKSSPEKILVNKIITLTFPGIIINVLGQAIVNQLLSIQVIFSNPLSEPVEDCVLTLEGSG
FFKKQLRILIGDLKPHHKATITLKTIPFKSGQRQIQANLSSNKFKDIKGYKNVYVDFGL
Download sequence
Identical sequences ENSDORP00000006972 ENSDORP00000006972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]