SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006981 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006981
Domain Number 1 Region: 1421-1529
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-34
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 1767-1886
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 3 Region: 1944-2053
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-31
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 4 Region: 549-668
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 5 Region: 1241-1362
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 6 Region: 2296-2401
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 7 Region: 2116-2223
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 8 Region: 7-69,242-282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.54e-24
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1589-1704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-23
Family Spermadhesin, CUB domain 0.0053
Further Details:      
 
Domain Number 10 Region: 2674-2742
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 11 Region: 3029-3100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-17
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 12 Region: 3089-3158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 380-499
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-17
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 14 Region: 2914-2981
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-17
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 15 Region: 2731-2798
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.56e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 3209-3277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2970-3040
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 319-385
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000283
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2058-2126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000108
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1885-1947
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000337
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 21 Region: 2585-2648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 22 Region: 497-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000848
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 3141-3203
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 24 Region: 1186-1250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 115-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 26 Region: 1361-1424
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 27 Region: 2846-2906
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 843-899
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 1534-1601
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000607
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 30 Region: 1074-1128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000012
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 31 Region: 2228-2292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000361
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 1711-1774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 33 Region: 3268-3327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000653
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 1016-1078
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 35 Region: 2527-2602
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 2402-2463
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000306
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 37 Region: 2789-2856
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000334
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 38 Region: 668-727
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000639
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 938-1016
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000017
Family Spermadhesin, CUB domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006981   Gene: ENSDORG00000007436   Transcript: ENSDORT00000007442
Sequence length 3566
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2295:1420:327601:-1 gene:ENSDORG00000007436 transcript:ENSDORT00000007442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNCTFQLQGPNGTVESPGFPYGYPNYANCTWTITAEDQHRVQLVFQSFALEEDFDVLSVF
DGPPQPENLRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPSHTCGNPG
RLPNGIQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHAGFENSAMWDFPLPSCRXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFSAQYQVKKQIELKSRGVKLMPSKD
NHQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGTDFRLGSSVQFTCNEGYDLQGSKRITC
MKVSDMFAAWSDHRPVCRARMCDAHLRGPXXXXXXXXXXXXXXXXXHCVWIITALNPAKV
IKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTGTSVPDLIVSTNHQMWLLFQTDGS
GSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFHHGDTLKFECQPAFELVGQKAITCQK
NNQWSAKKPVCVFSCFFNFTSPSGIVLSPNYPEDYGNHLHCVWLILARPESRIHLAFNDI
DVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRGFNITF
TTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCVLKEGSVVWNS
AVLRCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITLQ
SDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLSDSEPLECEPNFQWSRALPSCEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFFTFHTFHLESGHDYLLITEN
GSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFVSDFSMSYEGFNITFSEYDLEPCEEPE
VPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPRCVAECGNSVT
GTQGTLLSPNFPVNYNNNHECIYSIQTQPGKGIQLRAKAFELSDGDVLKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFELIKCEDPGTPQFGYKV
HDEGHFAGSSVSFSCDPGYNLRGSEELLCLSGERRTWDRPLPTCVAECGGILRGELSGQV
LSPGYPAPYEHNLNCIWTIEADAGCTIGLHFLVFDTEEVHDVLRIWDGPVESGVLLKELS
GPMLPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVSTATSCNDPGVPQNGSRSGNSWEA
GDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCIAPCGGDLTGPSGVILSPNYPE
PYPPGKECDWKVTVSADYVIALVFNIFNLEPGYDFLHIYDGRDSLSPLIGSFYGSQLPAR
IESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDPGSIKNGTRVGSDLKLGSSITYY
CHAGYEVEGTSTLSCVLGPDGKPVWNNPRPLCTAPCGGQYVGSDGVVLSPNYPQNYTSGQ
SCLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQHARLLSSLSGSHTGESLPLATSN
QVLIKFSAKGQAPARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDFSVGAIVRFECNS
GYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPETYLNSLNCV
WKIMVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSNQLY
LHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVVSFQCEPGYALQG
HAHISCMPGTVRRWNYPPPLCIAQCGGAVEEMEGVILSPGFPGNYPSNMDCSWKIALPVG
FGAHIQFLNFSTEPNHDFIEIRNGPYETSRMMGRFSGSELPGSLLSTSHETTVYFHSDHS
QNRPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLSGYQLIGHPVLTCQH
GTNRNWDHPLPRCEVPCGGNISSPNGTVYSPGYPSPYSSSQDCVWLITVPIGHGVHLNLS
LLQTEPSGDFITVWDGPQQTSPQLGVFTRSLAKKTAHSSTNQVLLKFHQDAATGGIFAIA
FSAYPLTKCPPPTIFPNAEVVTENEEFNIGDIVRYRCLPGFTLVGNEILTCKLGTYLQFE
GPPPICEVHCPTNELLTDSTGVILSQSYPGSYPQFQTCSWLVRVEPDYNISLTVEYFLSE
KQYDEFEIFDGPSGQSPLLKALSGNYSAPLIVTSTGNSVYLRWSSDHAYNRKGFKIRYSA
SYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPL
CQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVTCPDVSSISVEHGRWRLIFETQYQFQAQLMLICDPGYYYTGQRVIRCQANGRWS
LGDSMPTCQIISCGELPVPPSGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANGLWS
GSEVHCLAIPTKLYLIFKLLDLPSPPSFSTKAGHCGTPEPIVNGHINGENYNYRGSVVYQ
CNAGFRLIGMSVRICQQDHHWSGKTPFCVPITCGHPGNPLNGLTQGNQFNLNDVVKFVCN
PGYISEGAARSQCLASGQWSDALPTCRIINCTDPGHQENSIRQVHASGPHRFSFGTTVSY
QCNHGFYLSTPVLSCQGDGTWDRLRPQCLLVSCGHPGSPPHSQMSGDSFTVGAVVRYSCT
GKRTLMGNATRMCGLDGHWTGSLPHCSGTSTGACGDPGIPAHGIRLGDSFATGSLMRFSC
EAGHVLRGSSERTCQANGSWSGSQPECGVISCGNPGTPSNARVVFSDGLVFSSSIVYECR
EGYYATGLLSRHCSVNGTWTGSDPECTVINCGDPGIPANGIRLGNDFRYNKTVAFQCVPG
YTMESHRVSVLSCTKDRTWNGTKPVCKAIMCKPPQLVPNGKVVGSDFMWGSSVTYACLEG
YQLSLPAVLTCEGNGSWTGELPQCFPVFCGDPGVPPRGRREDRGFSYRSSVSYSCHPPLV
LVGSPRRFCQSDGTWSGTQPSCIDPTLTMCADPGMPQFGIQNNSQGYQVGSTVLFRCQKG
YLLQGSTTRTCLPNLTWSGTPPDCVPHHCKQPETPTHANVGALDLPSMGYTLIYSCQEGF
SLKGGSEHRTCKADGSWTGKPPICLEVRPSGRPINTVREPPLTQASVPGDVFAKNSLWKG
AYEYQGKKQPAMLRVTGFQVANSKVNATMIDHSGVELHLAGHYKKEDFHLLLQVYQITGP
VEIFVNKFKDDHWALDGHVSSESSGGTFIYQGSVKGQGFGQFGFQRLDLRLLESDHESIG
RHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPFNGYAGHENTNVRATFENPM
YDRNIQPTDIMASEAEFTVSTVCTAV
Download sequence
Identical sequences ENSDORP00000006981 ENSDORP00000006981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]