SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006995 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006995
Domain Number 1 Region: 885-990
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-28
Family Cadherin 0.00064
Further Details:      
 
Domain Number 2 Region: 1668-1865
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-26
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 3 Region: 991-1092
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-24
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 823-891
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000004
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 1549-1644
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000158
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 6 Region: 1094-1196
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000286
Family Cadherin 0.01
Further Details:      
 
Domain Number 7 Region: 1359-1399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000174
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1957-1996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000435
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 1401-1438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000681
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1869-1902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000816
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000006995
Domain Number - Region: 2006-2051
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000706
Family Hormone receptor domain 0.0071
Further Details:      
 
Domain Number - Region: 1904-1942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000719
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1339-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00244
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 2547-2670
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0183
Family Rhodopsin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006995   Gene: ENSDORG00000007456   Transcript: ENSDORT00000007457
Sequence length 2958
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_614:42774:147208:-1 gene:ENSDORG00000007456 transcript:ENSDORT00000007457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSPPPVLPALVFLAAAAVLPALGSRAAAWEPRAPGGVRAVALGPGWVSLLDADRAVRA
PRGPLDVSRAGPQAGRRRGPRAGRPPPLPARPGTAGAPTAGNRLRVXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTYVLEDPVPQFRIDPDT
GTIYTMTELDYEDQAAYTLAITARDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSV
FEDAPPSTSVLQVSATDRDSGPNGRLVYTFQGGDDGHGDFYIEPTSGVVRTQRRLDRENV
AVYNLRALAVDRGSPAPLSASVEIQVAVLDINDNPPVFEKDELALFVEENSPVGSVVARI
QAHDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEVQRDYVLVVQATSAPL
VSRATVRIRLLDQNDNPPELPDFQILFNNYVTNKSNSFPSGVIGRIPAHDPDLSDSLNYT
FLQGNELHLLLLDPATGDLQLSRDLDNNRPLEALMEVSVSDGLHSVSALCTLRVIIITDD
MLTNSITVRLENMSQEKFLSPLLSLFVEGVATVLATSKDDVFVFNIQNDTDVSSNILNVT
FSALLPGGRFFPSEELQEHIYLNRTLLAAIAAQRVLPFDDNICLREPCENYMKCVSVLRF
DSSAPFVSSATVLFRPIHPITGLRCRCPPGFTGDYCETEIDLCYSSPCGDHGRCLSREGG
YSCECFQDFTGDHCQVNVRSGRCANGVCKNGGTCVNLLIGGFHCMCPPGEYERPFCEVST
RSFPPRSFVTFRGLRQRFDFISLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNIGRLGLPHGPSGEKVAVVTVDDCDTA
VAVHFGGYVGNYSCAAQGTQSGSKKSLDLTGPLLLGGVPNLPEDFPVHNRQFVGCMRNLS
IDGRSVDMAGFIANNGTRAGCAAQRNFCDGTSCQNGGTCVNRWNMYLCECPLHFGGKNCE
QAMPHAQHFSGESLVSWSDLDITISVPWYLGLMFRTQKEDGVLLEATAGLSSGLHLQILN
HYIRFEVSYGSSDVASLQLSRFRVTDGAWHHLLVELRSAKEGKDIKYLAVVTLDYGMDQN
TVQIGNQLPGLKMHSVVVGGVSEDQVSVRHGFRGCMQGVRMGETSTNIATLNMNDALKVR
VRDGCSVENPCASGPCPPHSRCQDTWDGYSCVCDKGYFGQKCVDACHLNPCKHAAACVRP
PGSPRGYACECGPGHYGPYCENENYYKPPAQDACLPCDCFPHGSRSRACNMDTGQCACKP
GVIGRQCNRCDSPFAEVTALGCEVIYSGCPRAFEAGIWWPQTKFGQPAAVPCPKGSVGNA
IRHCSGEKGWLPPELFNCTTGSFLDLKVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVVQAGSALLAPATRASWEQI
QRSQGGAAQLLQRFEAYFSTVARNVRRTYLRPFVIVTANMILAVDVFDKFNFTGARVPRF
EAVQDELPRGLESFVSFPADIFKPPERKEGPGVRAAIRRAVPTARPEPGPSRRRRHPEDP
GQFAVALVIVYRTLGQLLPERYDPDRRSLRLPSRPTINTAVVSTLLYSEGPPPPAPPPGP
VLVDFALLETEERTKPVCVFWNHSLDVGGTGGWSAKGCELVSRNRTHITCRCSHMASYAV
LMDISRREHGEVLPLKIVTYTAVAASLAALLVTFVLLALARTLRSLHSIHKNLTGALFSS
QLVFVVGINRTENPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAGPMRYH
VVGWGIPAIITGLAVGLDPQGYGNPDFCWLSLQDTLIWSLAGPIGAMILINTVIFVLSAK
VSCQRKHHYYERKGVVSLLRTAFVLLLLVSATWLLGLLAVNGDTLTFHCLFAAFSCLQGL
FVLLFHCLFHREVRRHLRAVLAGKKPHLEDASPTKATLLTRSLNCNHTFSEGPDMLRTTL
GESTASLDSTARDEGLQKLSVCSGPARGGLGEPEANFIPRNPTKTHGPDSDSDSELSLDE
QSSSYASSRSSDSEDDGGDAEEQWDPAGGPVHSTPKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILKNKVTY
PPPLPEQPLKCRLREKLADCEHSPASSRTSSLASGDGVRAPEGIISVTAPWREPGREHRN
GAAMSVCTGSAQANGSDS
Download sequence
Identical sequences ENSDORP00000006995 ENSDORP00000006995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]