SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006997 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006997
Domain Number 1 Region: 465-543
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000131
Family Blood coagulation inhibitor (disintegrin) 0.00055
Further Details:      
 
Domain Number 2 Region: 392-453
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000227
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.0048
Further Details:      
 
Domain Number 3 Region: 217-275
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000646
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006997   Gene: ENSDORG00000007459   Transcript: ENSDORT00000007459
Sequence length 745
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3901:41597:113121:-1 gene:ENSDORG00000007459 transcript:ENSDORT00000007459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPRVLILLLSWAAGLGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKXXXXXXXXXX
XXXXXXXXXHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGREGFIKTRGGTFYIEPAERYIKDRILPFHSVIYHEDDINYPHKYGPQGGCADHSVFER
MRKYQMTGVEEVAQTPQEEHAANGPELLRKKRTTLAERNTCQLYIQTDHLFFKYYGTREA
VIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSGTECTPGESKNLGQKENGNYIMYARA
TSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQREECDCGYSVQCKD
ECCFDANQEGKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAKEGICNGITALC
PASDPKPNFTDCNRHTQVCINGQCAGSICEKHDLEECTCASSDGKDDKELCHVCCMKKMD
PSTCASTGSVQWNRQFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFS
PQLYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRR
RPPQPIQQPQRQRPRESYQMGHMRR
Download sequence
Identical sequences ENSDORP00000006997 ENSDORP00000006997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]