SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007006 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007006
Domain Number 1 Region: 188-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-29
Family Spermadhesin, CUB domain 0.00000263
Further Details:      
 
Domain Number 2 Region: 370-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0000206
Further Details:      
 
Domain Number 3 Region: 31-82
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000249
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 4 Region: 142-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000061
Family EGF-type module 0.00056
Further Details:      
 
Domain Number 5 Region: 347-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007006   Gene: ENSDORG00000007468   Transcript: ENSDORT00000007468
Sequence length 436
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2260:14717:26585:-1 gene:ENSDORG00000007468 transcript:ENSDORT00000007468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDSDAMLLVLAGLLGALTAASSDPKAPEPVFGRLASPDFPGPYPHDRHYRWNMAAPPGHR
LLFYSTNYQLELSYLCEYNFIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIDECHVPPGDAPRCDHHCHNHLGGFYCSCRAGYELHKD
QRTCSALCSGQVFTARSGELSSPEYPEPYPKLSSCTYSIRLEESFRLSLDFVGSFDVETH
PEAQCPYDFLKIRTGHQEHGPFCGTTPPRRIETQSNTATITFVTDDSGDHTGWRLHYTST
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSLPLKSFVAVCQKDGSWDR
PMPQCSIVDCGPPDDLPNGRVNYITEPNVTTYKAVVQYSCRETFYTMKSNHSKYVCEADG
FWTSSKGEKSLPICEP
Download sequence
Identical sequences ENSDORP00000007006 ENSDORP00000007006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]