SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007018 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007018
Domain Number 1 Region: 29-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-66
Family Eukaryotic proteases 0.000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007018   Gene: ENSDORG00000007482   Transcript: ENSDORT00000007481
Sequence length 262
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_28692:9524:14978:1 gene:ENSDORG00000007482 transcript:ENSDORT00000007481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNSSAFLTSSLLIITFLLLISEDGCVQIIGGDQVIPHSRPYMVLLKLHKKRFCAGALIA
DDWVLTAAHCALTKTSEIILGAHSMSKNEPEKQKLSIKKEFPYPCFDPDTHEGDLKLIQL
NRKAKINKNVAILNLPKQGADIEAGTKCQVAGWGITNNKSPMSDTLREANITIIGRKICN
DHQHYNFNPVIGLNMICAGSPSGGKDICNGDSGGPLLCHGTFRGIAAFGRNGKCGDPRAP
GVYTLLSKHYLKWIIKTMKGVS
Download sequence
Identical sequences ENSDORP00000007018 ENSDORP00000007018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]