SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007024 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007024
Domain Number 1 Region: 364-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number 2 Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 3 Region: 93-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 4 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 5 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number 6 Region: 413-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007024
Domain Number - Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000167
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 140-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 58-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00153
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007024   Gene: ENSDORG00000007488   Transcript: ENSDORT00000007488
Sequence length 494
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6498:13085:135023:1 gene:ENSDORG00000007488 transcript:ENSDORT00000007488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRGVRNLLLLASSLLFVGLSAVPQGFSPSLRSWSGAPCRLSRAESERRCRAPGQPPGG
ALCHGRGHCECGVCICHVTQPGTYFGPLCECHEWVCQTYDGNTCAGHGTCDCGRCKCDVG
WSGDACQYPTNCELTRKRSNQMCKNSQDIICSNAGTCHCGRCKCDDSDGNGLVYGKFCEC
DDRECIDDETEEICGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGQICS
NRGTCVCGECSCHDVDPTGDWGDIHGDTCECDERDCRPVYDRYSDDFCSGHGQCNCGRCD
CKAGWYGKKCEHPRSCPLSAEESSRKCQGTSELPCSGRXXXXXXXXXCYPPGDSRVYGKT
CECDDRRCEDLEGVVCAGHGTCSCGRCVCERGWFGAHCQHPRKCNMTEEQSRSLCESADG
ILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGW
NGNACEIWLGTEYP
Download sequence
Identical sequences ENSDORP00000007024 ENSDORP00000007024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]