SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007045 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007045
Domain Number 1 Region: 91-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-35
Family SPRY domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007045   Gene: ENSDORG00000007510   Transcript: ENSDORT00000007511
Sequence length 1311
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5448:108284:136122:1 gene:ENSDORG00000007510 transcript:ENSDORT00000007511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKGGGVSFSSKNYRLSSDAEKSRVTGIAHKKLLNDYLYHIFSSPDHEPSTTTSRKSLN
FQNLPEHLDQLLQVDEDEEGQGQVEGRLGPATVVLDHTGGFEGLLLVDDDLLGVIGHSNF
GTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEGVGDTHNSYAYDGNRVRKW
NVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLARGLGMAYFPAISLSF
KESVAFNFGSRPLRYPVAGFRPLQDPPRADLVRAQKLLGCFRAVLSVELDLVEGRLVPKE
SSKWQLQGQPTVLLTLAHIFHRFAPLLRKVYLVEAVLMSFLLGVVEKAPEETHAVVHQVL
DLLWLFMEDFEIQDCLKQLMMSLLRLYRFSPIVPDLGLQIHYLRLTISILRHEKSRKFLL
SNVLFDMLRSVVFFYIKSPLRVEEAGLQELIPTTWWPHRSSKEGRESKEVKEETPEERQR
RRAYERGCQRLKKRIEGVEELQVQILKLLDNKDENGSEASRYIFLTKFRKFLQENASGRG
NMPMLCPPEYMVCFLHRLISALRFYWDEYKASNPGAAYSEEAYIPPQIFYNGKVDYFDLQ
RLGGLLSHLRKTLKDDLASKANIVIDPGELQAAAMDDLDEDEEPAPAAAQRPLQALAIGG
ALPLPRPGWLSSPTLGRANRFLSTAAVSLMTPRRPLSTSDKVKVRTLNVEQRTRDDIEGS
HWNEGLLLGRPPEEPEQPLTENSLLEILDGAIMMYNLSVHQQLGKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXRKDILEELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYWLLR
VCLRTIEHGDRTGSLFAFMPEFYLNVAINSYSALKNYFGPVHSMEELPGYEETVTRLAAI
LAKHFADTRIVGTDIRDSLMQALASYVCYPHSLRAVERIPEEQRIAMVRNLLAPYEQRPW
AQTNWILVRLWRGCGFGYRYTRLPHLLKTKPEDANLPSLQKPCPSVLLQQHMADLLRQGP
DVAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSVSLLR
VLEMTITLVPEIFLDWAQPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLESV
DHYPILVAVTGILVRLLVHDSASETERATSVLLADPCFQLRSICYLLGQPEPPAPGTTLP
APDRKRFSLQSYTDYISAEELAQVEQMLAHLTAASAQAAAASLXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXACINQHLMNNKDCFFCKIPPSLLTCEQPQWNPSHGPNYA
Download sequence
Identical sequences ENSDORP00000007045 ENSDORP00000007045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]