SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007149 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007149
Domain Number 1 Region: 364-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-44
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 111-173
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000259
Family B-box zinc-binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007149   Gene: ENSDORG00000007625   Transcript: ENSDORT00000007625
Sequence length 557
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6795:25547:43986:-1 gene:ENSDORG00000007625 transcript:ENSDORT00000007625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDLMASGPLPTITTYPMAPVSSDSGSASSVEEDVGYLGRPVEKTEGQNNDEAQPGAS
NGEGEEEILCDFCLGASRVRAVKSCLTCMVNYCEEHLRPHQENSKLHSHQLTEPAKDQDL
RTCPAHHNPLVAFCCTDQQCICQECGQYEHKSHTSVSLEAARRNKEADLRCTQINLEQKL
KLNENAIARLQANHKSVLVSVSEVKVVAEEQFGELLAAVRKAQADVMLFLEEKEHAALNQ
ANSIKTHLEYRSAEMEKSKQELARLAAISNTVLFLEEYSKFKNAEDTAFPSVYIGLKDKL
SGIRKVITDSTTDIIQLLENYKEKLQEFAKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXACDITFDPDTAHRYLRLQEDNRKVTNTSPWEHPYPDHPSRFVYWRQVLSQQSLYLH
RYYFEVEISGAGTYVGLTCKGIDRKGEERNGCISGNNFSWSLYWNGKEFTAWHSDTETPL
KADPFRRLGIYIDFPGGVLSFYGIEYDAMTLVHKFDCKFSEPVYAAFWLSKKENAIRIVD
LGEEPEKPASSAVEAAP
Download sequence
Identical sequences ENSDORP00000007149 ENSDORP00000007149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]