SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007242 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007242
Domain Number 1 Region: 271-394,507-596
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.14e-25
Family WD40-repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 102-159
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000123
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007242   Gene: ENSDORG00000007727   Transcript: ENSDORT00000007727
Sequence length 598
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_915:71702:88282:-1 gene:ENSDORG00000007727 transcript:ENSDORT00000007727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRAPLDAYFQVSRTQPQLPAASSDSETRNPRSEDLHVSGGSHSDSDSSVENEEVVGQAEE
PGTVISEEQERVTTAEEEVPFISEGNTQSKQQSPQKSACMGEEEEEDEGDTCTICLEQWT
NAGDHRLSALRCGHLFGYRCISKWLKGQARKCPQCNKKAKHSDIVVLYARTLKALDNSEE
ERIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLQKLIVWHRDQILRQP
GCSQGSLPTCLSFSQGQHKYHFQKNFTVSQTGNCRIMAYSDALSCLAISQPSPQAAFLPG
FGVKMLSTANMKSSQYIPMHSKQIRGLAFNQESRGLLLSASLDNTIKLTSLETNTVVQTY
NTGRPVWSCCWCLDENNYIYAGLANGSILVYDLRNTGFHMQELVPQKARCPLVSLSYMTR
AASAAFPYGGVLAGTLENASFWEQKSDFSHWPHVLQMEPGGYVDFQIENRTRHCLVSYRP
DKIHKTIRSVLMELSYKVGDTGETLCSCQPVQTFLGGPTCKLLTKNAIFQSPVNDGSILV
CTGDEATNSAQLWSACSGSILQTLKCDQPVLDICPFDVNHNSYLATLTEKTVHIYKWE
Download sequence
Identical sequences ENSDORP00000007242 ENSDORP00000007242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]