SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007335 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007335
Domain Number 1 Region: 134-196
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000552
Family Ankyrin repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007335
Domain Number - Region: 269-306
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00903
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007335   Gene: ENSDORG00000007824   Transcript: ENSDORT00000007825
Sequence length 762
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4106:190588:430839:1 gene:ENSDORG00000007824 transcript:ENSDORT00000007825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASLNRKLPFKDRHVTCSKIIGRRLACFAQRLSYRREQSQCDLLNESTGQLPTTCSSVA
PNNLKWNYCVKMTQQMQNLHLSQSKKHNAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFR
SRSDRLSLRKTSVNFQGNEAMFEAVEQQDMDAVQLLLYQYTPEELDLNTPNSEGLTPLDI
AIMTNNVPIAKILLKTGARESPHFVSLESRAMHLNTLVQEAQDRVSELSAQVENEGFTLD
NTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEVPTNACLMVTSSTSLTVSFQEPLSINAA
VVTRYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTPACASSNWKDYDDREPRHKGQSEVLESLLQQVRALHQHYSCRESSKLQTTGRKQSVSR
SLKHLFHSSNKFVKNLKRGLYIAVIFYYKDNMLVTNEDQIPIVEIDDSYTSSIMQDFLWF
TKLSCMWEDIRWLRQSVPISMSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKDR
HGNMLIVTIREVEMLYSFFNGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYYK
RSHQRLSPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKVRENNNISKEEWEWIQKLSG
SESMESVDHTSDCPMQLFFYELQMAVKALLKQINIPLHQARNFRLYTQEVLEMGHNVSFL
LLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences ENSDORP00000007335 ENSDORP00000007335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]