SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007343 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007343
Domain Number 1 Region: 1389-1493
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.73e-30
Family Lipoxigenase N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 22-155
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-24
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 3 Region: 268-341
Classification Level Classification E-value
Superfamily PKD domain 0.00000314
Family PKD domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007343
Domain Number - Region: 888-1038
Classification Level Classification E-value
Superfamily ARM repeat 0.013
Family Armadillo repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007343   Gene: ENSDORG00000007832   Transcript: ENSDORT00000007833
Sequence length 2455
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4971:43929:121622:-1 gene:ENSDORG00000007832 transcript:ENSDORT00000007833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVACLLLLGLTLRFGATIVKPEEGSFCSKSQVAFRDACYEFVPLGRTFHGAQGWCEGQG
GHLVFIPDEGTQQFLQMHISQDREWWIGLTGTSAPNGTSAGPGTWLDTSNVSYSNWQGSQ
AAPAPHSCGYIRRGPSSDWAVSEDCTEAFAFVCEFGVGQSLACEGFNATMHCGSGEVIRM
QDAFYGRQTPYYCTQGTWGPSDLEEECSWANVKEEVAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLRLVLPTESFIFDNVTLSLTWLLSPYIGNLSCMLSMGDGHTLDPY
YPPSVSSRVTHQYTSPGEFTVFVECTTSEWHVTAQKQVTVRDNMGRLSVTGCAGLFHSRA
SPVCQAVFGDPLWLQVELDGGTGVTYTVLWDNITLAEFATQGSMPHNLTLTRETQELMGP
GTHLLEIQAISNTLASSGNVTVHFVELLSGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFLVTVLVRNTFSNLSLEVGNITVTXX
XXXXXXXXXXXXXXXRDKGDLEVYVKPGLYVDPFTTVTLGWPADDEDFRFRWSCXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXCEQNCQLADANEDVLLRVTLGEDTSAATFSWYLDSSSPDKAEPLPAVCRLTGFQTR
SLTLLQGDTSTLLLNSSSLQTWGQVLWIRVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCLHCGPEPALPSVYLPLGKDNKDFVLTV
IISVTNQAGERQQTHAMVKVGLGDTGIKEGEFQVAMLERVTAALQGEHGPEQLLQLAKSL
SSVLNQEDLGQDSGQLLTMDTRQKVRELVLQSLSKVIGSLEDMQSVQGLAEVLRELTHLS
EELTPSAQWVASRALQQASEVLLTASTKARPEDQRRQAATRDLLWAVGNILEAFPSNQPE
EPMDANSSQVPTLARMLEAVERVQTSLLLGTLPGALPATLATPSISVYTNRIQPRTWRGS
SVFIAATDSATFSLPASSLWPIEDDSEPVDIRMTSFPKSPFPAGSRFDISGTVGGLLVTS
PGGQPIPVKNLSENIEILLPRHLEGLNEPTVLDLAAPGTLWVNVTAGGAALGIQLHGRPY
LPLTLSLGYGYHPNETSYDAQTHLPPAAVPGELSTWILGPADLPLGEGIYYLTVVPESNL
KPDPGKALTVGVTTFLSHCVFWDEVQETWDNSGCQVGPRTTASQTHCLCNHLTFFGSTFL
VMPNAVDIHQTAELFATFEDNPVVVTTVGCLCLVYVLVVIWARRKDAEDQAKRRVTVLED
NDPFAQYHYLVTVHTGHRRGAATSAKVTITLYGLDGESDPHHLSDPDFPVFERGGVDVFL
LSTLFPLGELQSLRLWHDNSGDQPSWYVSRVLVYDPATDQKWYFLCNSWLSIDIGDCVLD
KVFPVATEQDRKQFSHLFCMKTSAGFQEGHIWYSIFSRSARSSFTRVQRVSCCFSLLLCT
MLTSIMFWGVPQHPAEQKMDLGKIEFTWQEVMIGLESSVMFPINLIVQIFRNARPRVTKE
QNTGNQGGRTTSPTSSPQSIDDVLLTPDEVTKTRCLAGYEETRQLTVSSEGAIASFKLEF
LKSDGAQRPPGLGGRHRLSREQGRAGALRSQEEQGPCHTHSWIYASRRENTTPQAAGLEC
PLEGQYLQAVSLPSAGACGEGAEAGGASGLPTAPQLCSGPQAAADLETLSRRRVWPLGPS
TYQCRIPRASRPLRGLPWWCVLVGWLLVAATSGVAAFFTMLYGLHYGHASSLRWLISMAV
SFVESVFITQPLKVLGFAAFFALVLKREDEVDNVSLLQEHLHGPGPCARSRMRRHSSKDY
QPPLAAAVERMKTTRLKEQKAYALIREVVAYLGFLWMLLLVAYGQRDPSAYHFNRHLEHS
FTQGFSAVLGFQGFFEWANTTLMNNLYGHHPGFVTDGNSKLVGSAHVRQVRVRKSSCPLA
QQLQASFDGCHAPYSLDVEDLADYGEGWTASAPNTGSTRASVSVGAIPCGANSQCTGEEA
MWSPWGPIAKTRQDRLLQYLFDHTWLDTLTRAVFVEFTVYNANVNLFCIVTLMLETSALG
TFFTHATLQSLRLYPFTDGWHPFVVAAELLYFIFLFYYMVVQGKLMKRLKWGYFSSKWNL
LELAIILASWSALAVFVKRAVLAERDLQYYREHRAGGISFSETASADAALGYIIAFLVLL
STVKLWHLLRLNPKMSMITSALCRAWGDISGFTTVIVIMFLAYSIASNLIFGWQLHSYKS
LFDAAETLISLQLGIFNYEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLSEEGEIVDLLLEKMLSFLGVGCKREMPSSGQTKSPCEAQLTQPEQALPGV
Download sequence
Identical sequences ENSDORP00000007343 ENSDORP00000007343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]