SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007355 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007355
Domain Number 1 Region: 119-244,278-340
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.65e-45
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000107
Family Ankyrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007355   Gene: ENSDORG00000007845   Transcript: ENSDORT00000007845
Sequence length 415
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6264:3297:43968:1 gene:ENSDORG00000007845 transcript:ENSDORT00000007845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLFEKKVNINAVDIMNRTALHFAVGGNNLSAVDFLLSHKARVDVADKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRG
RKPFLLAAERGHVEMIEKLIFLNLQTSEKDKEGNTALHLAAMHGHSPAVQVLLTQWQEVN
ETNENGETPFFLAVEGGHEECSKMLLAAGSDVNVPNKLHVSVLQIAIRNGHTSLVNFLLS
ENIDLHLRMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQRTPLHIAADLGNVEA
VEALLQAGCHLKLTDKQGKTALAVASRSNHSLVVDMLIKAERYYAWREXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRAIEAQWS
Download sequence
Identical sequences ENSDORP00000007355 ENSDORP00000007355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]