SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007356 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007356
Domain Number 1 Region: 152-309
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.87e-18
Family Ankyrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007356   Gene: ENSDORG00000007846   Transcript: ENSDORT00000007846
Sequence length 759
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6196:31309:60896:1 gene:ENSDORG00000007846 transcript:ENSDORT00000007846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPSSPPAFRLETSDGDQEDGTEAVKGKPGPPPMESPFQGEDRNFSPQIKVNLNYRKGL
KARQQDPNRFDRDRLFSIVSRGASEDLAGLLEYLRRTSKYLTDSEYTEGSTGKTCLMKAM
LNLQGVNACILPLLQIDRDSGNPQPLVNAQCTDEYYRGHSALHIAIEKRSLQCVKLLVEN
GANVHARACGHFFQKHQGTCFYFGELPLSLAACTKQWDVVTYLLENPYQPASLQAADSLG
NTALHALVMIADNSPENSALVIRMYDGLLQLGARLCPTVQLEDIHNLQGLTPLKLAAKEG
KIEIFRHILQREFSGLCQPLSRKFTEWCYGPVRVSLYDLASVDSWEENSVLEIIAFHCRS
PHRHRMVVLEPLNKLLQAKWDLLIPRFFLNFLCYLVYMLIFTIVAYHQPALDKQALSPMK
ATAGNSMLLFGHVLILLGGIYLLLGQTWYFWRRRLFIWISFMDSYFEILFLVQALLTVLS
QVLCFVNNEWYLPLLVSSLVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLLVYLV
FLFGFAVALVSLSREAQITGVPTGDNATEAAQLSAGQEKEETPYRGILDASLELFKFTIG
MGELAFQEQLRFRGVVLLLLLAYVLLTYVLLLNMLIALMSETVNSVATDSWSIWKLQKAI
SVLEMENGYWWCRRKKQRAGVMLTVGTRPDGSPDQRWCFRVEEVNWASWEQTLATVCEEP
SGAGISGSSKNPISSSQPVEDQDRDSEKDHLPLQVLQSH
Download sequence
Identical sequences ENSDORP00000007356 ENSDORP00000007356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]