SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007368 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007368
Domain Number 1 Region: 35-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.42e-121
Family Bee venom hyaluronidase 0.0000134
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007368
Domain Number - Region: 422-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0059
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007368   Gene: ENSDORG00000007858   Transcript: ENSDORT00000007858
Sequence length 472
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6814:60246:63804:-1 gene:ENSDORG00000007858 transcript:ENSDORT00000007858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTGLGPVITLALVLAVAWAAELKPTTPPIFTGRPFVVAWDVPTQDCAPRHKVPLDLSVF
DVEASPNEGFVNQNITIFYYNRLSLYPRFDSTGMSVHGGVPQNGSLWAHLQMLKKSVEHY
IRTQEPPGLAVIDWEDWRPVWVRNWQDKDVYRQSSRQLVASRHPDWPADRIVKQAQYEFE
FAARQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYAQNWETYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLAFRQSRNFVSFRVQEALRVAHTHHANHALPVYVFTQPTYTRK
LSGLTEMDLISTIGQSAALGAAGVILWGDSVYTSSVETCQYLKNYLTQKLVPYVVNVSWA
TQYCSWTQCHGHGRCVRRNPNANTFLHLSANSFRLVPGQASDKPHLQPEGELSRADLSYL
QTHFRCQCYLGWGGEQCQWDRRQSTGGANGGWTGSYLTSLMALATIALTWTL
Download sequence
Identical sequences ENSDORP00000007368 ENSDORP00000007368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]