SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007536 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007536
Domain Number 1 Region: 24-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.19e-51
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 251-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007536   Gene: ENSDORG00000008032   Transcript: ENSDORT00000008032
Sequence length 294
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1237:16125:37851:-1 gene:ENSDORG00000008032 transcript:ENSDORT00000008032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQQRGRSGGRTLRPGSASDTILFTSPLMGDVVSDWSPMHDAAIHGRLLSLRNLLSQGW
PVNLITADQVSPLHEACLGGHSSCVNLLLSHGARVNCTTVDWHTPLYNACVNGSRECADL
LLRHGASPHPVNDVASPMHEAAKRGHLECIESLITYGGDIDHNINHLGTPLYQACKHQHV
DCAKRLLQSGANVNLGKGLDSPLHVVARGSNDKMACLLIDFGADMHAKDIDGKRPVDLVS
PESPVTQIFMEREGPPSLMQLCRLRIRKCFRSHQHYKIGSLFLPEELKEYLLHA
Download sequence
Identical sequences A0A1S3GFE1
ENSDORP00000007536 XP_012887578.1.60039 ENSDORP00000007536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]