SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007546 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007546
Domain Number 1 Region: 98-299
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.52e-45
Family Ankyrin repeat 0.000000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007546   Gene: ENSDORG00000008039   Transcript: ENSDORT00000008042
Sequence length 766
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_847:46740:56893:-1 gene:ENSDORG00000008039 transcript:ENSDORT00000008042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEDGPAAGPAAAAAAARERRREQLRQWGARVSAEPGPGERRVRTVRFDRAAEFLAACA
GGDLDEARLMLRAADLGAEPEPAAPPPACAVLNSPGAECIXXXXXACIDENLEVVRFLVE
QGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAVEGL
LRAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYIEV
MRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLADE
EVLSLLEELAQKQEDLRNQKEASQSRGQEPQAPLSGKHRRSSVCRLSSREKISLQDLSKE
RRPAGAGAPPIRDDDEGEESPTEPPCPEPRALNGVSSPPSPGPKSLALPEEAAFPRRFGL
QKTGSSSALGPTERRGVEGAPGAGLQRSASSSQVEGTSAQVREPRLARIPPTPSRKVPDT
APLSDPARPPPLCRGPASPAKPDVPADSRDRRRSYQMPVRDEESESQRKARSRLMRQSRR
STQGVTLTDLKEAEKAAGKTPEPERSSMLSLDPPQRPRVPGVENSEGPAQRAEVPDGQGP
GPLAAREHSKPKASRERRGPAEGEEAEPGDYSPEGSAVDGGMARRQRAQQDLHPEPQPGP
EEPDGGFRKLYAELRRENERLREALTETSLRLAQLKVELERATQRQERFAERPALLELER
FERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKLSK
Download sequence
Identical sequences ENSDORP00000007546 ENSDORP00000007546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]