SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007552 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007552
Domain Number 1 Region: 391-584
Classification Level Classification E-value
Superfamily HCP-like 3.14e-45
Family HCP-like 0.00041
Further Details:      
 
Domain Number 2 Region: 198-322
Classification Level Classification E-value
Superfamily HCP-like 7.72e-24
Family HCP-like 0.0028
Further Details:      
 
Domain Number 3 Region: 116-169
Classification Level Classification E-value
Superfamily Kringle-like 2.31e-20
Family Fibronectin type II module 0.00075
Further Details:      
 
Domain Number 4 Region: 565-698
Classification Level Classification E-value
Superfamily HCP-like 0.00000000000141
Family HCP-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007552   Gene: ENSDORG00000008046   Transcript: ENSDORT00000008049
Sequence length 792
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_548:1118:41650:-1 gene:ENSDORG00000008046 transcript:ENSDORT00000008049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRVGLTLLLCTVLLGAASASSDDEGSQDEPLDSKDSLPSDESVKDHPTAGRVIAGQIF
LDSEESELESSVQEEEDNLKSQEGESVAEEISFLESPNPDKDNEEAKKVQKPVLTAIEGT
AHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYNYKTDEKWGFCETEEEAAKRRQMQ
EAEMIYQTGMKILNGSNKKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNIQA
AKSMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYRY
WAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLI
QYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYS
EGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQG
WVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHT
AVELFKNVCERGRWSERLMTAYNSYKDGDYNSAVTQYLLLAQGYEVAQSNAAFILDQREA
TIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQH
SAQAXXXXXXXXXXXXXXXXDIHLAKRFYDMAAEASPDAQVPVFLALCKLGIVYFLQYIR
ETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPMPRPPGPRPAPP
QQEGPPEQQPPQ
Download sequence
Identical sequences ENSDORP00000007552 ENSDORP00000007552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]