SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007555 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007555
Domain Number 1 Region: 160-354
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.35e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 470-579
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-37
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 785-891
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-35
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 4 Region: 915-1008
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-28
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 621-740
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-21
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 6 Region: 357-428
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 7 Region: 732-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000918
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 8 Region: 581-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000051
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007555   Gene: ENSDORG00000008052   Transcript: ENSDORT00000008052
Sequence length 1019
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_978:98557:206437:-1 gene:ENSDORG00000008052 transcript:ENSDORT00000008052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSATALRALVPLLLPPLLLLLPLPRGAGGLGGRSEAADYWAPEGEAGAELQLEHYHDPC
KAAVFWGDIALDEDDLKLFHIDKTQDWTKPSEEEMGHNTGGLEEHASENWLNTTASASNT
SSQAARKDGKEETILLHSSDTSKATIKTFSARVRRATTSRTERIWPGGVIPYVIGGNFTG
SQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNC
DKFGIVAHELGHVVGFWHEHTRPDRDQHVTIMRENIQPGQEYNFLKMEAGEVSSLGETYD
FDSIMHYARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGET
LQDTTGNFSAPGFPNGYPSYSHCVWRVSVTPGEKIILNFTSMDLFKSRLCWYDYVEVRDG
YWRKAPLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMCGGDITKDSGQ
IQSPNYPDDYRPSKECVWRITVSDGFHVGLTFQAFEIERHDSCAYDYLEIRDGPTQDSAL
IGHFCGYEKPDDVKSSSNRLWMKFVSDSSINKAGFAASFFKEVDECSWPDHGGCEQQCVN
TLGSYMCACDPGYELATDKKTCEVACGGFITKLNGTITSPGWPGYPNKNXXXXXXXXXXX
XXXXXXXXXXXXXXXVCKYDFVEVRSGLSPDARLHGKFCGSETPEVITSQSNNMRVEFKS
DNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYRLHENEHDCKEAGC
AHKISSAEGTLATPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEM
YDGPDILAPTLGRFCGSKKPEPIVASGSSLFLRFYSDASVQRKGFQAAHSTECGGRLKAE
VQTKELYSHAQFGDNNYPSQARCDWVIVAEDGYGVELIFRTFEVEEEAECGYDYMEAYDG
YDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFHTDDTINKKGFHAQYTSTKFQDALHMKE
Download sequence
Identical sequences ENSDORP00000007555 ENSDORP00000007555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]