SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007593 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007593
Domain Number 1 Region: 178-491
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.49e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0079
Further Details:      
 
Domain Number 2 Region: 60-157
Classification Level Classification E-value
Superfamily ISP domain 2.75e-26
Family Rieske iron-sulfur protein (ISP) 0.029
Further Details:      
 
Domain Number 3 Region: 495-572
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.34e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007593   Gene: ENSDORG00000008091   Transcript: ENSDORT00000008092
Sequence length 581
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1026:41859:49236:1 gene:ENSDORG00000008091 transcript:ENSDORT00000008092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELKIEVVLPEKERGKEELSAGGKGSPRAYQGNGTARHFHTEERLPAPHPYPGPQDCVEAA
VCHVKDLENGQMREVELGWGKVLLVKDNGEYHALGHKCPHYGAPLVKGVLSRGRVRCPWH
GACFNINTGDLEDFPGLDSLHKFQVKIEKEKVYIRASKQALQLQRRTKVMAKCISPSAGH
SGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDAQPEQLAL
RPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKSLSCKGKEV
ENVFTIRTPEDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRKF
LGTRVGRALMKMFENNRVKFYMQTEVSELRAQEGKLKEVVLKSSKVLRADVCVVGIGAVP
ATGFLRQSGISLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHV
QGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTK
GDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFMLHS
Download sequence
Identical sequences ENSDORP00000007593 ENSDORP00000007593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]