SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007596 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007596
Domain Number 1 Region: 112-298
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-73
Family F-box associated region, FBA 0.0000000144
Further Details:      
 
Domain Number 2 Region: 35-117
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000106
Family F-box domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007596   Gene: ENSDORG00000008096   Transcript: ENSDORT00000008095
Sequence length 298
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_7898:53100:59881:1 gene:ENSDORG00000008096 transcript:ENSDORT00000008095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGDPESVGQPEEASPEEQPEEEAAASAEEEEEQPGEEAEAAAAAYLAELPEPLLLRV
LAELPAAQLVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPAGDADDSREHWQHFYFLSK
RRRNLLRNPCGEEDLEGWSDVEHGGDGWRVEEMPGDGGVDFIHDDSVKKYFASSFEWCRK
AQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRNDAGCLYELTVRLLSEHEDVLAEFNSGQ
VAVPQDSEDGGWMEISHTFTDYGPGVRFVRFEHAGQDSVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences ENSDORP00000007596 ENSDORP00000007596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]