SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007602 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007602
Domain Number 1 Region: 1093-1313
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.66e-80
Family Fibrinogen C-terminal domain-like 0.00000163
Further Details:      
 
Domain Number 2 Region: 657-821
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-21
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 3 Region: 922-1018
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-19
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 4 Region: 566-654
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-18
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 5 Region: 1006-1094
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000321
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 6 Region: 395-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000143
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 7 Region: 484-574
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000979
Family Fibronectin type III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007602   Gene: ENSDORG00000008100   Transcript: ENSDORT00000008102
Sequence length 1334
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2227:29404:94885:1 gene:ENSDORG00000008100 transcript:ENSDORT00000008102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPALRSAAGGDQLKEAVGLAVVPSSLPGFVEHLFPLSPRMGVQGTLSFPLGLLLGSVLLV
TSAPATPEPQGCSSKDQQVTVSHTYKIDVPKSALIQVEADPQSLSDDGASLMALGEAGEE
QNFIFRHNIRLQTPQKDCDLADSVQDLLARVKKLEEEMAEMREQCSAQRCCLGAAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAVVGTAWVTEETETSLDVEWENPLTDVDYF
KLQYGPLTGQEVAEVNVPKSRDPKSRYDITGLKPGTDYKITVFPMRGGLEGKPILLNGRT
EIDPTNVVTNQVTEDSAAVWKPVRADIDKYVVRYIAPDGETKEKAVSKDQSSTVLTGVKP
GEAYKVFVWAERGNQGSKKADTKALTELDSPANLVTDRVTENTASVSWDPVEADIDRYVV
SYTSVDGETREVPVDKEKSSTILTGLRPGVEYKVYVWAQKGDRESKKANTKAPTDIDSPK
NLVTDRVTENTISVSWEPVQASIDRYVVSYTSADGETKEVPVGKEKTSTILTGLRPGMEY
KVHVWAQKGTQESRKANTKAPTDIDGPKNLVTDQMTENTASVSWEPVEADIDRYVVRYTS
ADGETWEVPVDKEKSSTILTGLRPGVEYKFDVWAQKGIQESRKASTKAPTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXIDSPKNLVTNRVTETTATISWEPVRANIDRYMVRYTSADGE
TREAPVPKDQSSTILTGLRPGVEYTVHVWAKKGARESKKADTKALTEIDPPRNFRPFGVT
HSGGVLTWMSPTAQIDGYILTYQFPNGTVKEVRLQRGEQRFELQGLEQGVTYPASLVAFK
GDRRSKSVSTTLSTVDARFPHPSDCTQVQQNSNAASGLYTIYLNGDASRPMQVYCDMDTD
GGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTPTRYEVRADLQ
TSNESAYAVYDFFQVASSKERYKLSVGKYRGTAGDALTYHNGWKFTTFDRDNDIALSNCA
LTHHGGWWYKNCHLANPNGKYGETKHSEGVNWEPWKGHEFSIPYVELKIRPHGYSRDRFS
GRKKRSLAGKMRMF
Download sequence
Identical sequences ENSDORP00000007602 ENSDORP00000007602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]