SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007625 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007625
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 5.56e-72
Family Integrin A (or I) domain 0.00000195
Further Details:      
 
Domain Number 2 Region: 1126-1311
Classification Level Classification E-value
Superfamily Fibronectin type III 7.15e-38
Family Fibronectin type III 0.00000396
Further Details:      
 
Domain Number 3 Region: 1516-1717
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-34
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 625-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.97e-18
Family Integrin beta tail domain 0.0021
Further Details:      
 
Domain Number 5 Region: 988-1095
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000123
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000387
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.025
Further Details:      
 
Domain Number 8 Region: 580-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007625
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007625   Gene: ENSDORG00000008126   Transcript: ENSDORT00000008127
Sequence length 1812
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2764:11038:43744:1 gene:ENSDORG00000008126 transcript:ENSDORT00000008127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLHPIPWTMVLLAALLSISLPGGMANRCKKAQVKSCTECIRVDKDCAYCADEMFKERR
CNTQKELLAAGCRLESVVVMESSLEITEATQIDTALRRSQVYPQRLQARLRPGEERHFEF
EVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTDDVKEFWDKLQGERISGNLDAPEGGFDAIL
QTAVCTRAIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDDTGTYIQYK
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVDLLE
EAFYRIRSNLDIRALDSPRGLRTEVTSKMFQKTKTGSFHIRRGEVGTYDVQLRAVEDVDG
THVCQLADDDQRGNIHLKPSFSDGLQMDVDIICDVCACELQKEVRSARCHFQGDFMCGHC
VCNEGWSGKTCNCSTGSLSDTQPCLREGEDRPCSGRGECQCGRCVCYGEGRYEGHFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGASCDCPLSNATCIDSNGGICNGRGYCECG
RCHCNQQSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCQECSFKVKMVD
ELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHRKKDCPPGFFWGLILPLI
LLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDTVRWKITNNVQRPGFATHAASSNPAELVPYGLSLRLTRLCTENLMKPGTRE
CDQLRREVEENLEVYRQFSAKLQQXXXXQQPNAGKKQDHTIVDTVLMAPRSAKQTLLKLT
EKQVEQRAFHELKVAPGYYTLTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLV
EAIDVPVGTATLGRRLVNITIIKEQASGVVSFERPEYSVSRGEQVARIPVTRRILDNGKS
QVSYRTQDSTAQGNRDYVPMEGELLFHPGETWKELQVKLLELQEVDSLLRGRQIRQFHIQ
LSNPKFGARLGQPHVXXXXXXXXXXELDRNFISQTLSSLPPSGGDPGAPQNPNAKAAGSR
KIHFNWLPPPGKPLGYRVKYWIQGDPESEAHLIDSKVPSVELTNLYPYCDYEMRVCAYGS
QGEGPYSTLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGDITAYEVCYGLVN
EDNRPIGPMKKVLVDNPKKRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPK
RPMSIPIIPDIPIVDAQGGEDYENYLMYSDDVLRSPASSQRPSVSDDTGGGGSGWKLEPL
PGEELDLRRVTWRLPPELIPRLSASSGRSDDKAGQQDPEGGGGRCTTPRPPGEHLVNGRM
DFAFPGSANSLHRMTAANAAYGTHLSPHLSHRMLSTSSTLTRDYHSLTRTEHSATLPRDY
STLTSLSSQDSRAAAGVPDTPTRLVFSALGPTSLKVSWQEPQSERMLLGYSVEYQLLNGG
DLYRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCP
LPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGGPATTF
RVDGDNLESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGT
LNTQVDQQFFQT
Download sequence
Identical sequences ENSDORP00000007625 ENSDORP00000007625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]