SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007641 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007641
Domain Number 1 Region: 350-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-31
Family SPRY domain 0.0021
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily RING/U-box 1.7e-18
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 93-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000153
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007641   Gene: ENSDORG00000008145   Transcript: ENSDORT00000008145
Sequence length 507
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2764:158557:164004:-1 gene:ENSDORG00000008145 transcript:ENSDORT00000008145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAEQLREKLNCSICLGLYRDPVTLPCGHNFCGDCIRDSWRRCEQSCPECREPCPAGAEPR
RNVALSQVLELLCAGLARGPRADPDPRAGPGPGPGARCPRHGRPLELFCRTEGRCACCAC
TVHECRLHERVLLDEERREREGQLRARLEVTQQRSTQAETQLQDLQQQTTHIQSSACTLA
SMVSSKFSCLLQALEKRQALALENIETAKTQALAQIQDEERQLRGHLEALTQYGRRVHDL
LTQGDHQTFLQESQQLLEPPAPLGPRTPVQWDEDEQLSDLKESLSPLCGLLLEEQHPPRM
PAKAAHSLPADTVGPQAPVSSMLCPLRKQLWQXXXXXXXXXXXXXXXPFYLSHEDQQVTH
HREPQGPARPGSFELWQVQCAQGFRAGRHYWEVLTSDHSVTLGVTYPELTRRKQGMNTDN
IGRGPDSWGLCIQEDSVQAWHNGKAQRLPRASGRLLGMELDLDVGYLTFYSLEPQAQQLH
TFNAFFNHPVYPVFWLLEGRTLTLCHH
Download sequence
Identical sequences ENSDORP00000007641 ENSDORP00000007641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]