SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007675 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007675
Domain Number 1 Region: 43-153
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.92e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 170-298
Classification Level Classification E-value
Superfamily TIMP-like 6.75e-24
Family Netrin-like domain (NTR/C345C module) 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007675   Gene: ENSDORG00000008180   Transcript: ENSDORT00000008180
Sequence length 308
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4173:30090:34032:-1 gene:ENSDORG00000008180 transcript:ENSDORT00000008180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAALALLLGALHGAPVRSQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYK
RMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCE
AVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHS
ADGLMEQMCSSDFVVKMRIKEIKRENGDRKLIGAQKKKKLLKPGPLKRKDTKRLVLHMKN
GASCPCPQLDSLTGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYPCSLYYPF
FYGAAESH
Download sequence
Identical sequences ENSDORP00000007675 ENSDORP00000007675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]