SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007680 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007680
Domain Number 1 Region: 514-618
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.06e-29
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 87-238
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000127
Family FAD/NAD-linked reductases, N-terminal and central domains 0.07
Further Details:      
 
Domain Number 3 Region: 986-1017
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000513
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007680
Domain Number - Region: 1018-1047
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00026
Family LIM domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007680   Gene: ENSDORG00000008186   Transcript: ENSDORT00000008185
Sequence length 1114
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2848:76002:136376:1 gene:ENSDORG00000008186 transcript:ENSDORT00000008185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQTHVGHVFENFVQASTCKGTLQAFNMLTRLLDLDPLDHRNFYSKLKSSVTTW
KAKALWYKLDKRGSHKEYKRGKSCVNTKCLIVGGGPCGRTAIELYLGAKVVVVEKRDFSR
NNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNVEF
VKVLEPPEDQENQKIGWRAEFLPMDHALSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAI
AITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFVMTA
KKQSLLDKGVIINDYIDTEMLLCAENVNQENLLSYAREAADFATNYQLPSLDFAMNHYGQ
PDVAMFDFTSMYASENAALVRERQSHQLLVALVGDSLLEPFWPMGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVRPHQ
VKHLYITKELDRYPLERLGSVRRSASLSRRESDIRPNKLLTWCQQQTEGYEHVNITDLTT
SWRSGLALCAIIHRFRPELINFDSLNEDDAVGNNQLAFDVAEREFGIPPVTTGKEMASSQ
EPDKLNIVMYLSKFYELFRGAPLRPMDSWRKNYGENADISLAKSSISNHYLNLTFPRKRT
PRVDVQTEEKDMNKRRRRGLSNLEELSTFSCNLDANQECGSRKEGRNQNKVKSMANQLLA
KFEESSKNNLVLKQEHRNSGIGKPALCSSSNPPVLSHCPKPEEPTSSPPPPLKRQFPSVV
TGQVLRELNQVSAGSERMNRPWRARAKSDLQLGGPENLPALPPNCQRALALSGVLQRLQQ
VEEKILQKRAQNLANREFHKKNIKEKAAHLASMFGHGDIPQNKLLSKGLSHTHPPSSPSC
LPSPDPAATSSQSTVESASPARKKLSPSGSHFKSRHLRILTVGKVSSGIGAAAEVLVNLY
LNDHKPKAQATSPDLDSMRKVFPLGLGGSDTCYFCEKRVYVMERLSAEGHFFHRECFRCS
VCANTLRLAAYAFDCDEGKFYCKPHFIHCKTNNKQRKRRAELKQQKEEEGPWQEQEAPRR
DTPTESSCAVAAISTPEGSPPVHFSLPVLHPLLG
Download sequence
Identical sequences ENSDORP00000007680 ENSDORP00000007680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]