SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007683 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007683
Domain Number 1 Region: 12-60,94-121
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000425
Family Ankyrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007683   Gene: ENSDORG00000008189   Transcript: ENSDORT00000008188
Sequence length 158
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6123:8062:11543:1 gene:ENSDORG00000008189 transcript:ENSDORT00000008188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLDRTPEVEGLRPLLESGASVNAPPDPYEQSPVHLAAGGGLAGFLLRQLQAGADLNQQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCNKNGQTAEDLAWSCGFPECAKFLTMIK
CMQTVKSNEQSNRDDCVPSLKQKRCIGSVENTNVKRKC
Download sequence
Identical sequences ENSDORP00000007683 ENSDORP00000007683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]