SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007684 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007684
Domain Number 1 Region: 23-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.45e-28
Family Laminin G-like module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007684   Gene: ENSDORG00000008185   Transcript: ENSDORT00000008189
Sequence length 1833
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3096:57437:160781:1 gene:ENSDORG00000008185 transcript:ENSDORT00000008189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFLFAWILVSFACHLASTQGAPEDVDVLQRLGLSWTKAGGSRSPAPPGVIPFQSGFIFTQ
RARLQAPTATVLPAALGTKLALVLSLCSHRVNHAFLFAVRNRRHRLQLGLQFLPGKTVVH
LGPRRSVAFDLDVHDGRWHHLALEFRSRSVTLVTACGRRRVPIPLPFQRDPTLDPQGSFL
LGKMSPHAVQFEGALCQFSVHPVAQVAHNYCAYLRRQCGRADLYRPQLGAPFPPDSGSPF
AFQPDLAFLGLENLTSATPALGTRPTGRVPTATVAPATALRPLRTNPGDPPQHSARGDPA
WTPLPPAKLSTRKAPPPLPPASLNSATQTPRPAVAQPWQKISATENPKPSAPSVIPAKSP
HPTLKTAPPSFTKSAPPSQKPVRPTSVPALAIASGAQGKPTQRGPQTPRPPLPSARPLPP
ASGSSKKSIPLVAQTEAKLTSRAGKPVSARPSTPKPPQPTILHQSPALSSGSTRTARPPA
TTIVSPTSHTGTPRTAPPTFALGPVAAGSKKPTGLEASKKAGSKSSPWNPVPFWSGETFG
DVPLRDLTTRPSRQTTPAPVLAPARVLSSTSWPTNSGYSFFHLAGPTPFPLLLGPPGPKG
DCGLPGPPGLPGLPGPPGTRGPRGPPGPYGNPGLPGPPGAKGQKGDPGLSPGQAHDGAKG
DMGLPGLSGDPGPRGRKGHKGYPGPAGHPGEEGQLGAEGSPGAKGYPGRQGLPGPVGEPG
PKGSRGYIGLPGLFGLPGSDGERGVPGVPGKRGKMGRPGFPGDFGERGPPGLDGNPGDLG
LPGPPGVTGLIGDMGALGPIGYPGPKGMKGLMGGVGEPGLKGDKGEQGIPGVAGDPGFQG
DKGSQGLPGFPGARGKPGPLGRTGDKGSLGFPGPPGPEXXXXXXXXXXXXXXXXXXGKPG
ARGLPGPSGQLGPEGDEGPTGPPGIPGLEGQSGRKGFPGRPGPDGLKGEPGDPGRPGPVG
EQGLLGFIGLLGEPGITGEKXXXXXXXXPSAPGPKGSMGHPGMPGSVGTPGEPGPPGAPG
SRGPPGVRGAKGRRGPRGPDGPAGEQGSKGLKGPAGPRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXGPQGPQGLVGPPGEMGPKGPPGAVGEPXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGPEGKPGKQGEKGRTGAKGTKGYQGQLGEMGVPGDPGPPGTPGPKGARGSLG
PTGAPGRMGSQGEPGLAGYNGHKGVVGPLGPPGPKGEKGEQGEDGKAEGPPGPPGDRGPV
GDRGERGEPGDPGYPGQEGVQGLRGKPGQQGQPGHPGPRGRPGPKGSKGEEGPTGKPGKA
GAPGRRGMQGPPGLPGPRGVVGRQGPEGIAGPDGLPGRDGHAGQQGEQGDDGDPGPLGPA
GRRGNPGVAGLPGAQGPPGVKGESGLPGQLGPPGKRGTEGGMGLPGSQGEPGSKGQPGNS
GEMGFPGVAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIIGPLGILGPSGLPGPKGDK
GSRGDWGLQGPRGPPGPRGQPGPPVESEGPSYTFPVQQRDDLGAAFQTWMDMDGALRPEE
YSYSDHLVLDQGGQIFKTLHYLSNLIQSIKTPLGTKENPARVCRDLMDCEQKMVDGTYWV
DPNLGCSSDTIEVSCNFTHGGQTCLKPITASKVEFAVSRVQMNFLHLLSSEVTQHITIHC
LNLTVWQEGPGHSLAKQAVRFRAWNGQIFEAGGQFRPEVSVDGCKVHDGRWHQTHFTFRT
QDPQQLPIVSVDNLPPASSGKQYRLEVGPACFL
Download sequence
Identical sequences ENSDORP00000007684 ENSDORP00000007684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]