SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007691 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007691
Domain Number 1 Region: 7-88
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.0000282
Further Details:      
 
Domain Number 2 Region: 317-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000228
Family LIM domain 0.00075
Further Details:      
 
Domain Number 3 Region: 288-316
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000277
Family LIM domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007691
Domain Number - Region: 227-319
Classification Level Classification E-value
Superfamily FdhE-like 0.012
Family FdhE-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007691   Gene: ENSDORG00000008196   Transcript: ENSDORT00000008196
Sequence length 362
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6123:67784:97649:-1 gene:ENSDORG00000008196 transcript:ENSDORT00000008196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQNVVLPGPAPWGFRLGGIDSQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTH
ADAQDRIKAAAHQLCLKIDRAETRLWSPQVSEDGKAHPFKINLEAEPQDMNYFEHKHNIR
PKPFIIPGRSSGCSTPSGIDGGSGRSTPSSVSTLSSICPGDLKVAAKMAPNIPLEMDLPG
VKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDNRD
EPTQPRQSGSFRVLQELVNDGADDRPAGTRSVRAPVTKPHGGAGSAPRMPLCDKCGSGIV
GAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCETHARARTRPPEGYDTVTLYP
KA
Download sequence
Identical sequences ENSDORP00000007691 ENSDORP00000007691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]