SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007695 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007695
Domain Number 1 Region: 615-773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-42
Family SPRY domain 0.0033
Further Details:      
 
Domain Number 2 Region: 432-532
Classification Level Classification E-value
Superfamily Fibronectin type III 4.61e-18
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000652
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007695
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0847
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007695   Gene: ENSDORG00000008199   Transcript: ENSDORT00000008200
Sequence length 791
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1125:1763:84271:-1 gene:ENSDORG00000008199 transcript:ENSDORT00000008200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPPTHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVIHCTDHXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQVKVPATPILQLEKCCTHNNSATLSWKQPPLSTVPADGYILELDDGSG
GQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEDTDSEEQTLP
FPVPSERLPLRRMSPFSSTLNLQPSFPGRSYFDFRSSPHQLSLHSSLQSLNAPGCNFETQ
SAPYSQLVDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVH
YWELTIDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEG
GITKGATIGVLLDLNRKTLTFFINDEQQGPIAFENVEGMFFPAVSLNRNVQVSGPLGVNS
FCLQLTPPQRR
Download sequence
Identical sequences ENSDORP00000007695 ENSDORP00000007695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]