SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007711 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007711
Domain Number 1 Region: 658-778
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 394-444
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000379
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 931-974
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000196
Family TB module/8-cys domain 0.00034
Further Details:      
 
Domain Number 4 Region: 268-345
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000405
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 5 Region: 1093-1141
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000144
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 6 Region: 343-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 7 Region: 986-1035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1026-1070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.006
Further Details:      
 
Domain Number 9 Region: 110-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007711   Gene: ENSDORG00000008215   Transcript: ENSDORT00000008217
Sequence length 1142
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3465:15164:33549:-1 gene:ENSDORG00000008215 transcript:ENSDORT00000008217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPLGAAGGLAPAMRGAGAAGLLALLLLPLLGPGGGAEGGPTGERGAGGGGALARERFK
VVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNGGQC
SSRNQCLCPPDFTGRFCQVPAGGGAAAGTIGSGPGPGRAGPLSTGALAPEGDSVASKHAI
YAVQVIADPPGQGDGPPAQHAAFLVPLGPGQLSAEVQAPPPVVNVRVHHPPEASVQVHRI
EGPNAEGPAPIQHLLPHPKPLHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQEDCCG
SIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDINECAMPGMC
RHGDCLNSPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRMVSPEYQCQHPLTTRLTR
QLCCCSVGKAWGTRCQRCPADGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVTTDPPVSEERSAQQSHSIATTTPARPFPELISR
PSPPTMHRFLPDLPPSRSAVEIAPTQVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECK
PHVCGDGGICINYPGHYKCSCYYGYRLKASRQPLCEDVDECRDPNSCPDGKCENSPGSFK
CIACQPGYRSQGGGVCRDINECAESSPCTPGWCENLPGSFRCTCAQGYAPGPDGHSCLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQECCCSLGAGWGDHCEIYPCPVYSSAE
FHSLCPDGKGYTQDNNIVNYGIPAHRDIDECVLFGAEICKEGKCVNTQPGYECYCKQGFY
YDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLNPEELDGTGS
QGTRGCPPEHGPERREVCWSQRGEDGMCVGPLAGPALTFDDCCCRQGRGWGTQCRPCPPR
SA
Download sequence
Identical sequences ENSDORP00000007711 ENSDORP00000007711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]