SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007749 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007749
Domain Number 1 Region: 150-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.24e-42
Family Ankyrin repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 18-116
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.29e-20
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 3 Region: 403-491
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000133
Family DEATH domain, DD 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007749   Gene: ENSDORG00000008259   Transcript: ENSDORT00000008259
Sequence length 491
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5003:8255:31419:1 gene:ENSDORG00000008259 transcript:ENSDORT00000008259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEDQAWDTHGLLPLEKQLHQAARQNHIERMKELMEKRVNVRARNHVGRVALHWAAAGHE
QAVRLLLKHKAAVDDEDSACLCFGMNALLLSAWFGHLPVLQVLVNAGAKIHCENKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGRTAFHRAAEHGQLDALDFLVGSGCDHTV
KDNXXXXXXXXXAGRGHAAVVQRLVDIGLDLEEQTVEGLTALHSAAEGIHPDCVQVLLRA
GSSVNALTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGASPLHLATSLNFPAVV
QLLIAAHSDLDAVDSRQQTPLHLAAEHAFQDVAEMLLVAGVDLNLKDKQGKTALAVAARS
NHVGLVDMIIKADRFYRWQDHLSCRDPSQPPRKSVTFKQDHRPETQPLRTLLWNLASNCL
RPHEWKRLADSWRFTEAHVSAIEQQWTGPRSYQEHGHRMLLIWLHGVDTAGEDPSKALFE
GLAAIGKRDLA
Download sequence
Identical sequences ENSDORP00000007749 ENSDORP00000007749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]