SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007768 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007768
Domain Number 1 Region: 315-455
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.57e-34
Family Fibrinogen C-terminal domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 237-276
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000987
Family Fibrinogen C-terminal domain-like 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007768
Domain Number - Region: 55-204
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0915
Family Hemolysin E (HlyE, ClyA, SheA) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007768   Gene: ENSDORG00000008279   Transcript: ENSDORT00000008278
Sequence length 460
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4528:127651:139048:1 gene:ENSDORG00000008279 transcript:ENSDORT00000008278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLIKLFVLLIPLVIASTIHQDNSSFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDF
VHKTKGQINDIFQKLNIFDQSFYDLTLQTNEIKKEEKELRRTTSKLQVKNEEVKNMSLEL
NSKLEGLLEEKILLQQKVGYLEEQLTNLIQSQPEIQEHPEVISLKTFVEQQDNNIKDLLQ
TVEEQYKQLNQQRSQIKEIENQLRRTGTQELIENSLSSKPRAPRTTPPFKLNETKNTEQN
GIPADCSTIYNRGEHTSGTYTIRPRNSHVFNVYCVINSXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLGLEKIYSIVKQSNYSLRIELEDWKNNMYFTEYSFHLGNHETNYKL
HLVEIASNIPKALPEQKDLVFSTWDHKAKGYLSCPESYSGGWWWHDVCEKNHLNGKYNKS
RAKSKPEKRRGICWRAQNGRLYSIKSTKMLIQPADLESFE
Download sequence
Identical sequences ENSDORP00000007768 ENSDORP00000007768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]