SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007789 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007789
Domain Number 1 Region: 243-393
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.88e-56
Family Fibrinogen C-terminal domain-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007789   Gene: ENSDORG00000008301   Transcript: ENSDORT00000008299
Sequence length 395
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1177:5589:19717:-1 gene:ENSDORG00000008301 transcript:ENSDORT00000008299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LERSIQTSLRSELAQAQQHVVQNQTATMLELGTNLLNQTTAKTRKLSDVEAQVLNQTSRM
EIQMLETSLSTNKLEKQLLLQGHELNRLQGRNSALETRLQALETQQRVELASLRDQRERL
RHQLGLQSGALAGLERSLRALGGNASSLQHRQLVDFVQRLVQARAGARASXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGFGDPAGEHWLGNEAVHQLTSRAAYSLRVELQDWEGQETYAQYERFQLGSEGQMYRL
SLSGYSGSAGDQSSLPMKGANFSTRDADNDECFCKCAQMMSGGWWFVACGLSNLNGIYYP
SGYHLRKLNGIRWHYFRGPSYSLRATRMMVRPVGG
Download sequence
Identical sequences ENSDORP00000007789 ENSDORP00000007789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]