SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007792 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007792
Domain Number 1 Region: 568-635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 497-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 3 Region: 624-680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000542
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 78-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000563
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007792
Domain Number - Region: 449-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007792   Gene: ENSDORG00000008303   Transcript: ENSDORT00000008302
Sequence length 781
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3679:35198:82536:1 gene:ENSDORG00000008303 transcript:ENSDORT00000008302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTISFLILVGFTGELQVFSXXXXXXXXXXXXXXXXXXXXXXXXXXTRRRLVAVYGQYGG
QPCAESAFETQACEPTRGCPIEEGCGERFRCFSGQCIIKSLVCNGNSDCEEDADEDRCED
SESRPSDIDKPPPNIELTGNGYNALTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGN
ILSYTFQVKVNNDFNYEFYNSSWSYIKHTSTEYTSASRRKSFFRSSSSNSRSYTTNTKEM
SRKKSYKLLVIQNTVEVAQFINNNPESLQLAEPFWKELSHLPSLYDYSAYRRLIDLYGTH
YLHSGSLGGEYRVIFYVDSGEIKQSGSGSREEKGCSSSDFKFIFTSSRSKCKELEDALKS
ASGTQSNVLRGDPFITGGEAAFVAGLSFLDLDNPAGNKRRYSAWAQSVTNLPQVIKQKLT
PLYELVKEVPCASVKRLYLKRALEEYLDESDPCHCQPCQNGGIATVAGTQCQCHCKPYTF
GVACEQGVLVGNQAGGVDGGWSCWTTWGPCVQGKKTRSRECNNPPPSGGGKACIGETTES
RPCQAEELEHLRLLEPHCFPLSLSPKEFCPPPPSLKDGFVQGEGATFPVGKNIVYACNEG
YSLIGDPVARCGQDLQWLVGEMRCQQLSCVLPELPNSIQSHPHKPFYTVGEKVTLSCSGG
MSLKGPSVFLCGSSLKWSPEMSNVQCVHKDIPTTQAMPECKRWEKLQNSRCICKMPYECG
SSLDVCARDERSKRTLRLTVCKLHVLHCQGRNYTLTGKDSCAPSASTEKACGACPLWGQC
D
Download sequence
Identical sequences ENSDORP00000007792 ENSDORP00000007792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]