SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007862 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007862
Domain Number 1 Region: 468-797
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.4e-53
Family Diacylglycerol kinase-like 0.0085
Further Details:      
 
Domain Number 2 Region: 970-1088
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-20
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007862   Gene: ENSDORG00000008377   Transcript: ENSDORT00000008377
Sequence length 1104
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3869:37862:52032:1 gene:ENSDORG00000008377 transcript:ENSDORT00000008377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFFRRHFQRKASGPGEGQRRPSSVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCL
PSCGVGIRGASRRRSSTVPPACNPRFSVETGPPEGAQLLGAPLLLAGLVGMEEEEERVDV
TNEASGAAQPSTRTPGPSPPRGPRPLLPMPRCLRRASSHLLPADVVCGQTLCGLRGHYRR
LSQQRPSGRRASGSTLGSTIPTHRRPLSRRRQVALRRKSAGPQAWSALLVKAITKSGLQH
LALPPPAPGAPCGDFERQIRSIVDWSESATYGEHIWFETNVSGDFCYVGEQYCVAKMLXX
XXXXXXXXXXXXXXXXXXXXXXXINFRCKPSFRESGSRNVREPTFVRHHWVHRRRQDGKC
RHCGKGFQQKFAFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHAAVVIPPTW
ILRARRPQNTLKASKKKKRTSFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPLLVFVNPKS
GGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTL
DQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLRAE
PNPEAGPEERDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFY
AGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCIVFLNIPRYCAGTMPWGHPG
EHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVLLTTAKAIPVQVDGEPC
KLTASRIRIALRNQATMVQKAKRRSTAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKE
QLKEASVPLGTVVVPGDSDLELCRAHIDRLQQEPDGAGAKSPTCQKLSPKWCFLDATTAS
RFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPASPCSPTPRSLQG
DAVPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDQQSRTLLHHAVSTGSKEVVRYLLD
HAPQEILDAVEENGETCLHQAAAMGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDT
ELAAYLENRQHYQMIQREDQETAV
Download sequence
Identical sequences ENSDORP00000007862 ENSDORP00000007862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]