SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007881 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007881
Domain Number 1 Region: 289-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000141
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 161-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000487
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 116-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000156
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 83-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000339
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007881
Domain Number - Region: 995-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 609-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 867-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0286
Family Laminin-type module 0.072
Further Details:      
 
Domain Number - Region: 952-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.035
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 378-407,463-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0596
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number - Region: 1160-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007881   Gene: ENSDORG00000008394   Transcript: ENSDORT00000008397
Sequence length 1395
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5649:214077:284075:-1 gene:ENSDORG00000008394 transcript:ENSDORT00000008397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHVCAEQELTLAGHRQPCVRAFIRTVPVWKPGCGQQAWCLGQERRTIYYMGYRQVYTTEA
RTVFRCCPGWSQQPGQEGCLSAECTAGFCFNGGRCAPGSAQLCHCPGGFQGPRCQYDVDE
CRSHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCLAISSCTLGNGGCQHQCVQLTATR
HRCQCRPEFQLQEDGRRCVRRSPCADGNGGCMHTCQARRGLAHCGCHAGYQLASDRKACE
DVDECATGLAQCAHGCLNTEGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGNGGCSH
GCSHTSTGPLCTCPRGYELDEDRKTCIDVDDCMDSPCCQQACANTPGGYECGCYAGYRLS
TDGCSCEDVDECASSRGGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPLEEPTVDLDGQ
LPFVRPLPHIAVLRDELPQLFQDDYGPEEEEAELRGEHRLLEKFVCLGDSFGHDCSLTCA
DCRNGGTCLPGLDGCDCPDGWTGLICNETCPPGTFGKNCSSACGCENGGTCGPVTGACRC
PPGVGGARCEDGCPKGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLYGRFCHLACPPWA
FGPGCSEDCSCERAHTQSCDPRDGGCSCKAGFRGRRCQEECEPGFFGPGCRHRCTCPPGV
ACDPVGGECRRQCPPGYLGEDCGQECPEGTFGVNCSGSCSCVAAPCHRVTGQCLCPPGRT
GEDCGADCPEGRWGLGCQEICPACEHGASCDPRTGACLCLPGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXPVTGRCSCAPGTGLSCQRACDSEHWGPDCVHPCNCSAAHGHCDAAS
GLCLCEAGYVGPRCEQRCPQGFFGPGCEQRCQCENEAACDHVSGACTCPPGWRGSFCERT
CPAGFFGLDCLSACNCSAGADCDPVNGSCICPAGRWGPRCSQACPALTYGLNCSQACSCS
NGASCDPVHGQCHCAPGWTGPSCLQACPAGLYGKNCQHSCLCQNGGSCHPVLGHCTCPEG
WTGLACENAHLCQCPGETWACHPTTGTCTCAPGYHGPGCQQRCPPGRFGPGCAHACGCLH
GGLCDAATGACACPAGFLGADCSQACPQGYFGLNCAQVCACGQGAACDPVTGTCRCPPGT
AGHCESGCPRGRFGQGCAHECDCKNGGWCHAGSGHCSCPLGWTGPHCEQACPVGRYGAAC
GLECSCRNGATCEPATGTCRCSPGFYGQACEHPCPAGFHGDGCQGVCECRQGAPCDPVSG
RCLCPAGFQGRFCERGCEPGFFGEGCGQRCGCDGGGPCHPTTGLCLCPPGRTGAACELEC
RAGRFGPGCALRCDCRGGADCDPVHGQCRCVDGYTGPTCQEGGPSRLPESPTPARGSVAT
WSASNRLSTSPVVHL
Download sequence
Identical sequences ENSDORP00000007881 ENSDORP00000007881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]