SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007897 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007897
Domain Number 1 Region: 312-647
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.16e-84
Family Ankyrin repeat 0.00000265
Further Details:      
 
Domain Number 2 Region: 1-119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.86e-24
Family Protein kinases, catalytic subunit 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007897   Gene: ENSDORG00000008414   Transcript: ENSDORT00000008414
Sequence length 667
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_18265:7381:17319:-1 gene:ENSDORG00000008414 transcript:ENSDORT00000008414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISDFGLAKVNGLSHTHDLSMDGLFGTIAYLPPERIREKTRLFDTKHDVYSFAIVIWGVLT
QKKPFSDEKNILHIMVKVVKGLRPELPPICRPRPRACSNLIQLMQRCWHEDPHERPAFQG
SGTGEGTHRARGALLLVPGKWQTTNGGKKSCAFSPPEEITSETEDLCEKPEEEVKEATPE
LGGKGSPEPRSEAEPGSSRLPPASAPPLGNDCSLSELLSQLDSGISQALEGPEALSPGSS
ECKRPSSSSSGKRLSGVSSVDSAFSSRGSLSLSFDREPSTGDLGTADIQKRKLVDAIVSG
DTSRLMKILQPQDVDLALDGGASLLHLAVEAGQEECVKWLLLNNANPNLTNRKGSTPLHV
AVERRARGVAELLLSRKISVNAKDEDQWTALHFAAQNGDESSTRQLLEKNASINEVDFEG
RTPMHVACQHGQENIVRLLLRRGVDVGLQGKDAWLPLHYAAWQGHLSIVKLLARQPGVSV
NAQTLDGKTPLHLAAQRGHYRVARILTDLCSDVNICSLLAQTPLHVAAETGHTSTARLLL
HRGAGKEAVTAEGCTALHLAARHGHLATVKLLLEEKANVLARGPLNQTALHLAAAHGHSE
VVEELVSADLIDLSDEQGFSALHLAARGRHAHTVETLLKHGAHINLQSLKFQGSPGATAT
LLRRSKT
Download sequence
Identical sequences ENSDORP00000007897 ENSDORP00000007897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]