SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007918 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007918
Domain Number 1 Region: 295-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-30
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 518-718
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-27
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 3 Region: 118-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000221
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 159-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000382
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 718-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000992
Family EGF-type module 0.024
Further Details:      
 
Domain Number 6 Region: 1126-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 1093-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000208
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 199-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000495
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000007918
Domain Number - Region: 59-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 21-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0719
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007918   Gene: ENSDORG00000008435   Transcript: ENSDORT00000008436
Sequence length 1233
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2894:12034:122237:1 gene:ENSDORG00000008435 transcript:ENSDORT00000008436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPKIYSRLIFYFSVFLLISKKTCGPSGCGHSGLCGPGPGGPACVCPAGRSCEVGRGGC
ASGPGRHACRGAGAGYACFCVPGFQGGRCETDVDEGAWCAPPAACLDRPGRYACVCIHCE
VEMDGCWSQCVNGATCQDVLGAYFCDCAPGFLGDHCEFDLDECASQPCLHGGLCVNGENR
YRCNCTGSRFMGPRCETSMPPCWSNPCDNNATCEDTADGYMCHCWPGIHCEGDVDECSSP
CQGGRCALPAGYTCHCPVANVLGPSFGGEDCAQALLGCAGGPCLNAGLCIPHLHGQHGFT
CLCPAGHAGAVCDTVTTLSFNGSGFLGVPGSTGNTTGSACHLSFGFQTVQPDALLLFRGL
GDTSVALQLLRGRIHLSIHGHSRSKAHLSLPHTTSDGEWHSVQVMFGETVTLALIDDICK
EKCTVGAPLESNHSMCAPQNSFLGGLPTGTANHGVSLLNVSDGPSTPPFIGCLQDILFDR
THITLENTAPGWSLNIQTGCRKDWCAGQTCQNRGRCMNLWLSYRCECDRPYTGPDCLSEY
VAGRFGQEDTTGYAVFHLDESYGQNFSISMFIRTHQTSGLLLALENSTFQYVRLWLEQGR
LALLTPGSPKLVVKVVLSDGNVHFVSLTITPNGIELYQSSQSLGFISAPTWTVQEGDMLY
VGGLPDRQETEVHGGFFKGCIQDIRLNNQKLEFFPNSTTGVSHHPSLVNVTQGCPGDNAC
KSNPCRHGGACYSLWDDFSCSCPAHTAGKACEEVRWCELSPCPPSAQCQPVPQGFEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH
SGLPSTACGNEKTNLTCYHGGSCIEFQAELKCICQPGFTGERCEEDIDECASRPCQNGGL
CQDLRNRFQCVCGAFSQRCELDLADDLIWDIFVATGSVLLALLFLFLLALIASIVASNKS
ATQGSYSPSRQEKESFRVEMWSHAPPPAVERLI
Download sequence
Identical sequences ENSDORP00000007918 ENSDORP00000007918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]