SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000007965 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000007965
Domain Number 1 Region: 150-509
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.65e-103
Family Neurolysin-like 0.00000000000501
Further Details:      
 
Domain Number 2 Region: 574-696
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.55e-28
Family Neurolysin-like 0.000000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000007965   Gene: ENSDORG00000008485   Transcript: ENSDORT00000008485
Sequence length 705
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1874:92338:141740:1 gene:ENSDORG00000008485 transcript:ENSDORT00000008485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIARCLSAVRGLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENCDLEKIKPEARRYLEKSIKMGKRNGLHL
PEQVQNEIKSMKKRMSELCIDFNKNLNEDNTFLVFSKAELGALPDDFIDTLEKTDDDKYK
ITLKYPHYFPVMKKCCVPETRRKMEMAFNTRCKEENTVILQQLLPLRAQVAKLLGYNTHA
DFVLELNTAKSTNHVTAFLDDLSQKLKPLGEAEREFILNLKKKECEEKGFEYDGKINAWD
LPYYMTQTEELKYCIDQEFLKEYFPIEVVTEGLLNIYQELLGLSFEQVTDAHVWNKSVTL
YTVKDRATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMSVAALVVNFSHPA
AGRPSLLRHDEVRTYFHEFGHVMHQICAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLTLRQIVLSKVDQSLHTNTSLDAASEY
AKYCTEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLQNFLKREPNQKAFLMSRGLHAPE
Download sequence
Identical sequences ENSDORP00000007965 ENSDORP00000007965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]